(data stored in ACNUC7421 zone)

EMBL: CP001700.PE156

CP001700.PE156       Location/Qualifiers
FT   CDS_pept        165467..167053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0156"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; multicopper oxidase type 1; KEGG:
FT                   sen:SACE_1822 spore coat protein (outer)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69111"
FT                   /db_xref="GOA:C7QHH2"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH2"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ACU69111.1"
FT                   /translation="MSGPRLSRRGALRLFGGAGAVAVLSPTLAGCAKPGNDGINPGTLS
FT                   SKAKLPKPFSIPLPILKPLAPDSTDAQGVHYSMTLKQAEVEILPGYRTKIFGYNGTFPG
FT                   PYLDVHAGTPMVVHQTNQLPVPIVTHLHGGLTPPSDDGFPTDLVFPQALADMADPGMAA
FT                   SMAGMDGMPSMKDPLAHLTAVQRDYVFPLNQRASTLWYHDHRMDFSGVQVWRGLFGLCV
FT                   LRDAEDDKLPLPKGEREIPLMIADRAFDADGQLIYPEKDPTLLGKPSMDKSIAAGAQGD
FT                   VILVNGAPWPYLEVAAVKYRLRLLNASNARRYELKLDGPGGGEFVQVGSDGGLLAAPLT
FT                   HSTLHMSPAERFDVVVDFSKYPVGSTVTLKNSAASGGPGQVMQFKVTSHAADDSSVPAT
FT                   LSTIEKLTVNGAKRRLVFALDGDQWHVNGKAFDPAHPLVKPEFGKTEQWTVTSVERHPV
FT                   HLHGAHFQVTGRGSGGLGEYDHGWKDTVELSPGSEITLAVRFDSYRGRYVAHCHNLEHE
FT                   DMGMMATIQVV"
     atgagcggtc cacgcctgtc ccgccgcggc gcgctgcggc tgttcggcgg cgccggcgcg        60
     gtggcggtcc tgtcgccgac gctggccggc tgcgccaagc ccggcaacga cgggatcaac       120
     ccgggaacct tgtccagcaa ggcgaagctg ccgaagccgt tcagcatccc gctgccgatc       180
     ctgaaaccgc tggctccgga ttccacggat gcccagggcg tccactactc gatgacgctc       240
     aagcaggccg aggtcgagat cctgcccggc taccggacga agatcttcgg ctacaacggg       300
     acgttccccg ggccgtatct ggacgtgcac gccggcacgc cgatggtcgt gcaccagacc       360
     aaccagctgc cggtacctat cgtcacgcac ctgcacggcg gtctgacccc gcccagcgac       420
     gacggcttcc ccaccgacct ggtgttcccg caggcgttgg cggatatggc ggatccaggg       480
     atggcggcgt cgatggctgg catggacggg atgccgtcga tgaaggatcc gctggcgcat       540
     ctgaccgcgg tgcagcggga ctacgtcttc ccgctcaacc agcgcgcttc cacgctctgg       600
     taccacgacc accgcatgga cttcagcggc gtgcaggtgt ggcgcgggct gttcgggctc       660
     tgcgtgctgc gcgacgccga ggacgacaag ctgccgctgc ccaagggcga gcgcgagatc       720
     ccgctcatga tcgccgaccg cgccttcgac gccgacggcc agctgatcta cccggagaag       780
     gacccgacgc tgctcggcaa gccgagcatg gacaagtcga tcgccgccgg cgcgcagggc       840
     gacgtgatcc tcgtgaacgg cgcgccctgg ccctatctgg aggtcgcggc ggtcaagtac       900
     cggctgcggc tgctcaacgc ctccaacgcc cggcgctacg aactgaagct ggacggtccc       960
     ggcggcggcg agttcgtcca ggtcggctcc gacggcggtc tgctggccgc gccgctgacc      1020
     cactccacgc tgcacatgtc gccggccgag cgcttcgacg tggtcgtgga cttctccaag      1080
     tacccggtcg gctcgacggt gacgttgaag aactccgccg ccagcggcgg acccgggcaa      1140
     gtgatgcagt tcaaggtgac ctcgcacgcc gccgacgact cctcggtccc ggccacgctg      1200
     tccacgatcg agaagctgac cgtgaatggc gccaaacggc gcctggtctt cgccctcgac      1260
     ggcgaccagt ggcacgtgaa cggcaaggcc ttcgacccgg cgcacccgct ggtgaagccg      1320
     gagttcggca agaccgaaca gtggacggtg acctccgtcg agcggcatcc ggtacacctg      1380
     cacggcgcgc atttccaggt caccggccgc ggttccggcg gactcggcga gtacgaccac      1440
     ggctggaagg acacagtgga gctgtctccg ggctctgaga tcaccctggc ggtgcggttc      1500
     gactcctacc gggggcggta tgtcgcgcac tgccacaact tggagcacga ggacatgggg      1560
     atgatggcga ccatccaagt ggtctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page