(data stored in ACNUC7421 zone)

EMBL: CP001700.PE157

CP001700.PE157       Location/Qualifiers
FT   CDS_pept        complement(167197..168402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0157"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; SMART: GAF domain
FT                   protein; KEGG: sma:SAV_4257 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69112"
FT                   /db_xref="GOA:C7QHH3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH3"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69112.1"
FT                   /translation="MSESRESPEIADLREALAASRRRESWLSAAADVITLMLIAVDPHE
FT                   VLTLVAERAREASGADHCSLLLQHVDGSWRIDVATGLAADQVRGAFVEPHRRSVQVAVT
FT                   GRALALEAGDVDPEELAPPFRRFGAIVYAALAQRDDRPIGTLVLANAPGGRTFDEEDAR
FT                   LATAFAHQAGLALALTEARAAEDRLAVYADRERIARDLHDLTIQRIFAAGLSLQTLSRR
FT                   LNSPGPDLPAAAGRLDGVIDELDAAIAEIRTTIFDLQLTADQEATSTRARVLREASRAA
FT                   RVLGFEPSVRFTGPLDSLVGGDTGAHLVAAVRETLANAAKHAGATRVEVVVTVETGPAT
FT                   TLTLDVLDDGGAPMPRWRPNPRTARQGLSNLAARARELGGSFHAGPADGDRGTRVSWRV
FT                   PL"
     atgtccgaat cacgcgaatc gcccgaaata gccgatctgc gcgaggccct ggccgcctcg        60
     cgccgccgcg agtcgtggct ctcggcggct gcggacgtca tcaccctgat gttgatcgcc       120
     gtggacccgc acgaggtcct gaccctggtc gccgagcgcg cccgggaggc ctccggcgcc       180
     gaccactgct cgctgctgct gcagcacgtg gacggcagct ggcgcatcga cgtggccacc       240
     ggactggctg ccgaccaggt gcgcggagcg ttcgtggaac cgcaccggcg gtcggtgcag       300
     gtggcggtca ccggccgggc gctcgcgctg gaggccgggg acgtggaccc ggaggaactg       360
     gcgccgccct tccgccggtt cggcgccatc gtgtacgccg ccctggcgca gcgcgatgac       420
     cggccgatcg gcacgctggt cctggccaac gccccgggcg gccggacctt cgacgaggag       480
     gacgcccggc tggccaccgc cttcgcgcac caggcgggcc tggcgctggc gctcaccgag       540
     gcccgcgccg ccgaggaccg gctggcggtc tacgccgacc gcgagcgcat cgcccgcgat       600
     ctgcacgacc tcaccatcca gcggatcttc gccgccggcc tgtcgctgca gacgctgagc       660
     cgccggctga actcccccgg cccggacctg cccgccgccg ccgggcgtct ggacggcgtc       720
     atcgacgaac tcgacgccgc gatcgccgag atccgcacca cgatcttcga cctccagctc       780
     accgccgacc aggaggccac ctccacccgc gcccgggtcc tgcgcgaggc ctcgcgcgcc       840
     gcgcgcgtcc tgggcttcga gccctcggtc cgcttcaccg gcccgctgga ctccctcgtc       900
     ggcggcgaca ccggggcgca cctggtcgcc gccgtccgcg aaaccctggc gaacgccgcg       960
     aagcacgccg gcgcgacccg ggtcgaggtg gtggtgacgg tagagaccgg accggccacc      1020
     accttgaccc tcgacgtcct cgacgacggc ggcgccccga tgccgcgctg gcgcccgaac      1080
     ccgcgcaccg cccgccaggg cctgtccaac ctcgccgccc gcgcccggga actcggcggc      1140
     agcttccacg ccggacccgc cgacggcgac cgggggacca gggtgtcgtg gcgggtcccg      1200
     ctgtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page