(data stored in ACNUC7421 zone)

EMBL: CP001700.PE158

CP001700.PE158       Location/Qualifiers
FT   CDS_pept        complement(168565..169635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0158"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: sma:SAV_4261
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69113"
FT                   /db_xref="GOA:C7QHH4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH4"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU69113.1"
FT                   /translation="MADDVQTPKLREALRGIPAYKAGKNPDASAFKLSSNENPYPPLPG
FT                   VLEAVQKSAENFNRYPDMGCSALSSEIAERFGVPVEHVATGTGSVGVAQQLLQATSGPG
FT                   DEVIYAWRSFEAYPIITQISGATSVRVPLTPEEHHDLDAMAAAVTDRTRLIFVCNPNNP
FT                   TGVAISEDALVRFLDRVPSDVLVVIDEAYREFVRDDSIPDGVDLYRDRPNVAVLRTFSK
FT                   AYGLAGLRVGFAIAHEPVAAALRQTAVPFGVNSLAQVAAIESLRAEKLLLERCEALVQE
FT                   RTRVTEALREQGWTVPESQANFIWLRLGERTAEFAAKAEAAGIVVRPFAGEGARITVGE
FT                   VEANDILLRVTAEFQE"
     gtggccgacg acgtccagac cccgaagctc cgtgaagcat tgcgcggcat ccccgcctac        60
     aaggcaggaa agaaccccga cgcctccgcc ttcaagcttt cctcgaacga gaacccttac       120
     ccgccgctgc cgggtgtcct ggaggcggtc cagaagtccg cggagaactt caaccgctac       180
     ccggacatgg gctgctcggc gctgagttcg gagatcgccg agcgcttcgg cgtgccggtg       240
     gagcacgtcg cgaccgggac cggctcggtc ggcgtggccc agcagctgct gcaggccacc       300
     tcgggtccgg gggacgaggt gatctacgcc tggcgctcct tcgaggcgta cccgatcatc       360
     acgcagatct ccggcgctac ctcggtgcgc gtcccgctga cccccgagga gcaccacgac       420
     ctggacgcga tggccgccgc ggtgaccgac cgcacgcggc tgatcttcgt gtgcaacccg       480
     aacaacccga ccggcgtcgc gatctccgag gacgccctgg tgcgcttcct ggaccgggtc       540
     cccagcgacg tgctggtcgt gatcgacgag gcgtaccggg agttcgtgcg ggacgacagc       600
     atcccggacg gcgtcgacct ctaccgcgac cgccccaacg tcgccgtcct gcgcaccttc       660
     tccaaggcct acggcctggc cggactccgc gtcgggttcg cgatcgcgca cgagccggtc       720
     gccgcggcgc tgcgccagac cgccgtgccg ttcggggtga acagcctggc gcaggtcgcc       780
     gcgatcgagt cgctgcgcgc cgagaagctg ctgctggagc gctgcgaggc gctggtccag       840
     gagcgcacgc gggtcaccga ggcgctgcgc gagcagggct ggaccgtgcc ggagagccag       900
     gccaacttca tctggctgcg tctcggcgag cgcacggccg agttcgccgc gaaggccgag       960
     gcagccggga tcgtggtgcg gccgttcgcc ggcgagggcg cgcggatcac cgtcggcgag      1020
     gtcgaggcga acgacatcct gctgcgggtc acagccgagt tccaggagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page