(data stored in ACNUC7421 zone)

EMBL: CP001700.PE159

CP001700.PE159       Location/Qualifiers
FT   CDS_pept        169720..170865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69114"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH5"
FT                   /inference="similar to AA sequence:KEGG:SACE_5011"
FT                   /protein_id="ACU69114.1"
FT                   /translation="MTLNGFAYGELSFGADGQPADPTQRGAAPAVALGADVTDLLVLSH
FT                   GWLDDPPRAQILYAGLTEAIVQAGGAPPGLAVLGILWPSKRFDAEPEVQVAATVAATDP
FT                   SGRAAESFVTRVRHRVGAQLELLPVTAEYANPGDHQATFFGLEPRALLEKFGSIEDGID
FT                   AVLNLSTYYEMKGRAGAVGKGLVPVLAAVREARPEVRLHLAGHSFGARVMASALANCEA
FT                   FPVSSVTLIQGAFSQFGFAKQWDGVHDGLFRPGLFGGRLKGPVVVTHSRHDHMVGLAYE
FT                   LASRMAGDQPDTTGMAGHVHVHDEYGAIGSHGALSTPESVWGTMLPVQGAGYAFPAGAI
FT                   SNLDGNAYIPNHYHVMTPEMGKVLVAAMTACEAEYGVAEAS"
     gtgaccctca acggattcgc ctacggagag ctgtcattcg gagcggacgg tcagccggcc        60
     gatcccaccc agcgaggcgc cgccccggcg gtggccctcg gcgcggacgt gacggacctg       120
     ctcgtgctct cgcacggctg gctcgacgac ccgccacgcg cgcagatcct gtacgccggc       180
     ctcaccgagg cgatcgtcca ggccggcggc gcgccgccgg gactggccgt cctcggaatc       240
     ctgtggcctt ccaaacgatt cgacgccgag ccggaggtcc aggtcgcggc gacggtggcg       300
     gcgaccgatc ccagcggccg ggccgcggag tccttcgtca cccgggtccg gcaccgcgtc       360
     ggcgcgcagc tggaactcct cccggtgacg gcggagtacg cgaaccccgg cgaccaccag       420
     gccaccttct tcggcctgga gccccgagcg ctgctggaga agttcgggtc gatcgaggac       480
     gggatcgacg cggtcctgaa cctgtcgacc tactacgaga tgaaaggccg ggccggcgcg       540
     gtcggcaagg ggttggtccc ggtgctcgcc gcggtgcgcg aggcccggcc ggaggtgcgg       600
     ctgcatctgg ccgggcacag cttcggggcg cgggtgatgg cctccgcgct ggccaactgc       660
     gaagcgttcc cggtgtcgtc ggtgacgctg atccagggcg cgttctcgca gttcgggttc       720
     gccaagcagt gggacggcgt acacgacggc ctgttccggc cggggttgtt cggcgggcgg       780
     ctgaagggac cggtggtcgt gacccattcg cggcacgacc acatggtcgg gctcgcgtac       840
     gagttggcgt cgcggatggc gggtgaccag ccggacacga cggggatggc cggccatgtc       900
     cacgtgcacg acgagtacgg cgccatcggg tcgcacggcg cgctgtccac gccggaatcg       960
     gtgtggggca ccatgctgcc ggtgcagggc gcggggtacg cgtttccggc cggggcgatc      1020
     agcaacctgg acgggaacgc ctatatcccg aaccactacc acgtcatgac gccggagatg      1080
     gggaaggtcc tggtcgcggc gatgacggct tgcgaggcgg agtacggggt ggcggaggcg      1140
     agctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page