(data stored in ACNUC7421 zone)

EMBL: CP001700.PE16

CP001700.PE16        Location/Qualifiers
FT   CDS_pept        complement(17749..18954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0016"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   sgr:SGR_3958 putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68971"
FT                   /db_xref="GOA:C7QFN2"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN2"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACU68971.1"
FT                   /translation="MTGFEHDPYQPEQPATGDPQPWGHPSSGPVLGPAHASASAYPPAY
FT                   PSASSPSPAASEPMPPYTPPITSITPGYGNPGEAGGLGGPGSFGGPGGFGGPGGPGGPG
FT                   YTTHPAFSPEPPRRPRRKRRMGMALIIAGTIAASAAAGGIAGTIASHNNSSNSASSSVP
FT                   LNNTSVNTPVSNQTGTPTTTVGQVAKAALPTVVQVSVESYQGKSVGSGVILTADGLILT
FT                   NNHVITDAANGNGQITITFNNGKTAQASIVGYDSGSDLAVIKAQSVSGLPTASLGDSSK
FT                   IQIGDTVVAIGSPDGLQSTVTSGIVSALNRQVTVSSESSSRFSSGSQVTYSAIQTDASL
FT                   NPGNSGGPLLNAQGQVIGINSAIYSPTSSANAQGGSVGLGFSIPIDQVKTMLAKLEGGQ
FT                   MS"
     atgaccggat tcgagcacga cccgtaccag ccggagcagc ccgccaccgg cgacccgcag        60
     ccgtggggcc acccgtcttc cgggccggtg ctcggtccgg cccacgcctc cgcgtcggct       120
     tacccgccgg cctacccgtc ggcctcttcg ccttcgccgg ccgcctccga gccgatgccc       180
     ccgtacacgc cgccgatcac ctcgataacg ccgggctatg gcaacccggg cgaggccggc       240
     ggtctcggcg ggcctggcag tttcggcggg cctggcggtt tcggcgggcc tggcggtccg       300
     ggcggtcccg gatacaccac gcatccggcg ttctcccccg agccgccgcg acgtccgcgg       360
     cgcaagcgcc ggatgggcat ggccctgatc atcgccggca ccatcgcggc ctcggccgcc       420
     gccggaggca tcgcggggac catagccagc cacaacaact cctccaacag cgcctcctcg       480
     agcgtgccgc tgaacaacac gagcgtgaac accccggtca gcaaccagac cggtacaccg       540
     accaccacgg tcggccaggt cgccaaggcc gcactgccca cggtggtcca ggtctcggtg       600
     gagtcctatc agggcaagtc ggtcggctcc ggcgtcatcc tgaccgccga cggcctgatc       660
     ctcacgaaca accatgtgat caccgacgcg gccaacggca acggccagat caccatcacc       720
     ttcaacaacg gcaagaccgc ccaggcgagc atcgtcggct acgacagcgg cagcgacctg       780
     gcggtgatca aggcgcagag cgtcagcggc ctgcccaccg ccagcctcgg cgacagcagc       840
     aagatccaga tcggcgacac ggtggtcgcc atcggctccc ccgacggcct gcagagcacg       900
     gtgaccagcg gcatcgtcag cgccctgaac cgccaggtga cggtcagcag cgagtcctcg       960
     agccggttct ccagcggcag ccaggtcacc tacagcgcga tccagaccga cgccagcctc      1020
     aaccccggca acagcggcgg cccgctgctg aacgcccagg gccaggtcat aggcatcaac      1080
     tcggccatct actcgccgac cagctccgcc aacgcccagg gcggcagcgt cggactcggc      1140
     ttctcgatcc cgatcgacca ggtcaagacc atgctcgcca agctcgaagg cggtcagatg      1200
     agctag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page