(data stored in ACNUC7421 zone)

EMBL: CP001700.PE160

CP001700.PE160       Location/Qualifiers
FT   CDS_pept        170983..171954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0160"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: bmj:BMULJ_02621 AraC subfamily transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69115"
FT                   /db_xref="GOA:C7QHH6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH6"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69115.1"
FT                   /translation="MSRRVVFLVFPRFQLLDLTGPLEVFSQADMLFSPGRQRYVTEVVA
FT                   LGAEPVTASDGLAVVPHRTLADAAELPIDTLVVVGGRGVRTAMTDPVYVEWVRAAAGRA
FT                   RRVTSVCSGTFLLAAAGLLDGRRAVTHWDSCEELAERFPEIRVEADPIFVRDDPLWTSA
FT                   GVTAGVDLALALVEDDLGAEVARRIAKQLVVFVQRPGGQAQFSTQLAAQRPGRDALRET
FT                   QTWIADHLDDNLSLAALARRAALSERHFSRVFRAETGMTVAAYVEAARIEAAQRLLEST
FT                   RDGLDRIARTCGFGTVETMHRTFNRTIRVTPGEYRRHFSSPR"
     atgagccgcc gcgtggtgtt cctggtcttt ccgcgcttcc agctgctcga cctcaccggg        60
     ccgctggagg tgttctcgca ggcggacatg ctgttctcgc cggggcggca gcggtatgtg       120
     accgaggtgg tggccctcgg cgccgagccg gtgacggcgt ccgacgggtt ggcggtcgtg       180
     ccgcaccgga cgctcgccga cgccgccgag ctgccgatcg acacgttggt ggtggtcggc       240
     ggccgtggag tccggaccgc gatgacggat ccggtgtacg tcgagtgggt tcgggcggcg       300
     gccggccggg cgcggcgggt cacgtcggtg tgttccggga cgtttctgct ggcggccgcg       360
     gggttgctgg acggccggcg tgcggtcacg cactgggatt cctgcgagga gttggcggag       420
     cggttcccgg agatccgggt cgaggcggac ccgatcttcg tccgtgacga cccgttgtgg       480
     acctccgccg gggtcacggc cggcgtggac ctcgcgttgg cgctcgtcga ggacgacctc       540
     ggcgcggagg tggcgcggcg gatcgccaag cagctggtgg tgttcgtgca gcggccgggc       600
     ggacaggcac agttcagcac gcagctggcg gcgcagcgtc cggggcgtga cgcgttgcgc       660
     gagacgcaga cgtggatcgc cgaccatctc gacgacaacc tcagcctggc ggcgctggca       720
     cggcgcgcgg cgctgagcga acggcacttc tcgcgcgtgt tccgcgccga gaccgggatg       780
     acggtggcgg cgtatgtcga ggccgcccgg atcgaggcgg cgcagcgtct gctggagagc       840
     acgcgcgacg gcctcgaccg gatcgcgcgc acctgtggct tcggcacggt cgagaccatg       900
     caccgcacct tcaaccggac gatccgggtc acgcccgggg agtaccggcg gcacttcagt       960
     tcccccaggt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page