(data stored in ACNUC7421 zone)

EMBL: CP001700.PE161

CP001700.PE161       Location/Qualifiers
FT   CDS_pept        171991..172635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0161"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sco:SCO6747
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69116"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH7"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69116.1"
FT                   /translation="MPRIAIPLFPGFMPLDVVGPYDVLRFLPDHEVVFVASDPGVINGA
FT                   DGGFGLQAQATPADIDTCDILLVPGGRGTRDHAARKDLTDWIARIHQTTTWTTSVCTGS
FT                   LLLGAAGILTDTDATTHWNAIPALESFGAHYTPERVVRRGKVVTAAGVSSGIDMALTLA
FT                   GLIEGDEFAQAVQLWIEYDPQPPHDTGSVAKAGADLTARTPGLIGGGGRRG"
     atgccccgca tcgccatccc gctgttcccc ggcttcatgc ccctggacgt cgtcggcccg        60
     tacgacgtcc tccgcttcct gccagaccac gaggtcgtct tcgtcgcatc cgaccccggc       120
     gtgatcaacg gcgccgacgg cggcttcggc ctccaggccc aagccacccc cgccgacatc       180
     gacacctgcg acatcctcct ggtccccggc ggccgaggca cccgcgacca cgcagcccgc       240
     aaggacctga ccgactggat cgcccgcatc caccaaacca ccacctggac cacctcggtc       300
     tgcaccggct ccctcctcct cggcgcagcc ggaatcctca ccgacaccga cgccaccacc       360
     cactggaacg ccatccccgc cctcgaatcc ttcggcgccc actacacccc cgaacgcgta       420
     gtccgccgcg gcaaggtggt caccgcagca ggagtttctt ccggcatcga tatggcactc       480
     accctcgcgg gactgatcga aggcgacgaa ttcgcccaag cagtccaact ctggatcgag       540
     tacgacccgc agcccccgca cgacaccggc tcggtcgcca aagccggcgc cgacctgacc       600
     gcgcggacgc cggggctgat cgggggcggc gggcggcggg gatga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page