(data stored in ACNUC7421 zone)

EMBL: CP001700.PE162

CP001700.PE162       Location/Qualifiers
FT   CDS_pept        172943..173746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0162"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sen:SACE_3371 3-oxoacyl-[acyl-carrier- protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69117"
FT                   /db_xref="GOA:C7QHH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69117.1"
FT                   /translation="MDLGLRGRVAVVTGGSKGIGLAVVRTLLEEGAFVVAVSRAGSAGL
FT                   GEVGGPNLLHVAGDLMDAGFAAEVVEQTVAAFGGLDILVNNAGGPPPGVVLPRGPFLGG
FT                   GDVDWQAVFDFNLFAVVRLTRVALPHLIERGGTIVNVSSTLARQPATNNYEYSAAKAAL
FT                   SHVSKGLAEEFGPQGVRVNTVLPGVTRTNWWTDEGGVADMFAGAMGIDRDTLLDKALPE
FT                   SLRLSMGRIVEPQEVADAVVLLASPRSRSTNGSEFVVDGGLLKEL"
     gtggacctcg ggttgcgtgg ccgggttgct gtcgtcaccg gcgggagtaa gggtatcggg        60
     cttgctgttg tcaggacgct gctggaggag ggggcgtttg ttgtggctgt ctcgcgggcg       120
     gggtcggcgg ggttggggga ggtgggtggg ccgaatctgc tgcatgtggc tggtgatctg       180
     atggatgcgg ggtttgcggc ggaggtggtt gagcagactg ttgcggcgtt cggggggctg       240
     gacattctcg tgaacaacgc tgggggtccg ccgcctgggg tggtgctgcc gcgtgggcct       300
     ttcttgggtg gcggggatgt ggattggcag gctgtcttcg acttcaatct gttcgctgtc       360
     gtgcggctga cgcgggttgc tctgccgcat ctgattgagc ggggcgggac gatcgtcaat       420
     gtctcctcga cgctggctcg gcagcctgcc accaacaatt acgagtactc ggctgcgaag       480
     gcggcgctca gccatgtgtc caagggcttg gctgaggagt tcgggccgca gggggtgcgg       540
     gtgaacacgg tgctgccggg ggttacgcgg accaactggt ggaccgatga gggtggggtc       600
     gcggacatgt tcgccggggc gatggggatt gatcgggaca cgttgctgga caaggcgttg       660
     cccgagtcgt tgcggttgag catggggcgg attgtggagc cgcaggaggt cgccgatgcg       720
     gtggtgctgt tggcgtcgcc gcggtcgcgg agtacgaatg ggtccgagtt cgttgtggac       780
     ggcgggctgc tgaaggagct gtag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page