(data stored in ACNUC7421 zone)

EMBL: CP001700.PE163

CP001700.PE163       Location/Qualifiers
FT   CDS_pept        173877..175469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0163"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: mjl:Mjls_4686
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69118"
FT                   /db_xref="GOA:C7QHH9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH9"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACU69118.1"
FT                   /translation="MPVLRSQLDPTSEAARADREAVLGALERIRELQQKVLAGGGEKYA
FT                   ERHRSRGKLLARERLDLLLDEDSPFLELAALAGTHDPAETVGGVSGIGTVSGVECMIGA
FT                   NDPTVKGGAVGPSGVAKQLRMLEIAERNRLPLISLTESAGADLPRQADIFVPGGASFKG
FT                   ISRLSAAGIPTLSIVFGSSTAGGAYVPGMSEFTVMVKNQAAVYLGGPPLVKMAINEDTD
FT                   DETLGGADMHARVSGLADYLARDERDAIRIGRQIIADLRWRKRGPGPTESADEPLYAAE
FT                   DLLSLAPMDLRRPVEVREILARVLDGSRFSEFKPLYGTTLVCGWGSIHGYPVGILANNG
FT                   ILFSEEANKGAHFVQLANAREVPLLFVQNITGFMVGSRYERGGIIKDGSKLINAVSNSA
FT                   VPHVTLMVGASYGAGNYGMSGRAYDPRFVFTWPNHRIAVMGGRELAGVMSIVQRQKAEK
FT                   AGQPYDEAADAQTREFVEAMVDGQSDAVYASGRLWDDGVIDPRQSRTVLGLALSAIDSG
FT                   PVVGTRAFAPFRM"
     atgcccgtgc tccgctccca gctggatccg acgtcggagg cggcgcgtgc cgatcgtgag        60
     gcggtgctcg gggcgctgga gcggatcagg gaactgcagc agaaggtgct ggccggcggg       120
     ggtgagaagt acgccgagcg gcatcggtcg cggggcaagc tgctggcgcg ggagcggttg       180
     gatctgctgc tcgacgagga ttcgccgttc ctggagctgg cggcgctggc cgggacgcac       240
     gatccggccg agaccgtcgg cggcgtgtcc ggcatcggga cggtgtccgg tgtcgagtgc       300
     atgatcggcg ccaacgaccc gacggtgaag ggcggcgcgg tcgggccctc gggggtggcc       360
     aagcagctgc ggatgctgga gatcgccgag cggaaccggc tgccgctgat ctcgctgacc       420
     gagtcggccg gcgccgatct gccgcggcag gcggacatct tcgtgcccgg cggcgcgtcg       480
     ttcaagggga tctcgcggtt gtcggcggcg ggcatcccga cgctgtcgat cgtgttcggc       540
     tcctcgacgg ccggcggcgc ctacgtgccc ggcatgagcg agttcaccgt gatggtgaag       600
     aaccaggcgg ccgtctacct cggtggtccg ccgctggtga agatggcgat caacgaggac       660
     accgacgacg agacgctcgg cggcgcggac atgcacgcgc gggtgtccgg tctcgccgac       720
     tacctggccc gcgacgagcg cgacgcgatc cgcatcggcc ggcagatcat cgccgacctg       780
     cgctggcgca agcgcggtcc gggaccgacc gagagcgccg atgaaccgct ctacgccgcc       840
     gaggacctgc tctccctcgc gccgatggac ttgcgccggc cggtcgaggt gcgggagatc       900
     ctggcgcggg tgctggacgg ctcgcgcttc tcggagttca agccgctgta cggcaccacc       960
     ctggtctgcg gctggggttc gatccacggc tacccggtcg gcatcctggc caacaacggc      1020
     atcctgttct ccgaggaggc caacaagggc gcgcacttcg tccagctggc caacgcccgc      1080
     gaggtcccgc tgctgttcgt gcagaacatc accggcttca tggtcggctc gcgctatgag      1140
     cgcggcggca tcatcaagga cggcagcaag ctgatcaacg cggtctccaa ctccgcggtg      1200
     ccgcatgtga cgctgatggt cggcgcctcc tacggcgccg gcaactacgg catgtccggc      1260
     cgcgcctacg atccccgctt cgtgttcacc tggccgaacc accggatcgc cgtgatgggc      1320
     ggccgggagc tggccggggt gatgtcgatc gtgcagcggc agaaggctga gaaggccggg      1380
     cagccgtacg acgaggccgc cgacgcccag acccgggagt tcgtcgaggc gatggtcgac      1440
     gggcagtccg acgccgtcta cgccagcggc cggctgtggg acgacggggt catcgacccg      1500
     cgccagagcc gcaccgtgct ggggctcgct ttgtccgcga tcgattccgg gccggtggtg      1560
     gggacgcgcg cgttcgcgcc gttccggatg tag                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page