(data stored in ACNUC7421 zone)

EMBL: CP001700.PE164

CP001700.PE164       Location/Qualifiers
FT   CDS_pept        175557..177545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0164"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; biotin/lipoyl
FT                   attachment domain-containing protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: mgi:Mflv_4614
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69119"
FT                   /db_xref="GOA:C7QHI0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI0"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACU69119.1"
FT                   /translation="MPTYPTFSTVLVANRGEIARRVFRTAKAMGLRTVAVYSDPDADAP
FT                   HVREADVAVALGGSTSAESYLDAAKILDAARKTGADAVHPGYGFLSENAGFAEACAQAG
FT                   IVFVGPSPDAIRKMGIKHEAKAIAKAAGVPVLPDALLTTDEPDDWRRSSEGVGFPLLVK
FT                   ASAGGGGKGMRLVSSVEELENAVSGARREAAAAFGDGTVFLERYLAASRHIEIQVFGDT
FT                   HGNAVFYGERECSVQRRHQKVVEEAPSSAVGAAVRAKMGEVACALVRELGYVGAGTVEF
FT                   LFDDTDDSYYFLEMNTRLQVEHPVTEEVWGQDLVRRQFEVAAGAVLTAPDPEALHGHAI
FT                   EVRLYAEDPARKYIPSPGTLALYEHADVPGIRYEDGVRSGSVVSHYYDPMLSKVVATGL
FT                   TRGEAALKLASALAGMRIQGLKTNRDQLVAILRDPDFLAGTTRTDFLDLHPALAAPEDR
FT                   TDVTAHLAAALAVSVHRRRSAGGATAFAPAGWRLLPYDGANAAWTRQDVRRAPETPITY
FT                   RFDSSTLYLIHGGAEYEVSLRDLGPDSVRVAVDGVDRLCRVRVAEDTVVWVDDSDGGHS
FT                   AWKPTPRFPEDADAFAADDGAAEVPGTVVAISVAAGDRVKAGQVLVSMEAMKMEHQVKA
FT                   GRDGVVGSVDCAVGQFVDAHQVLVTLT"
     atgccgacgt atccgacgtt ctcgaccgtg ctcgtggcca accggggcga gatcgcccgg        60
     cgggttttcc gcactgccaa ggcgatgggc ctgcgcaccg tcgctgtgta ctccgacccg       120
     gacgccgacg ccccgcacgt gcgcgaggcc gacgtcgcgg tggccctcgg cggcagcacc       180
     agcgccgagt cgtacctgga cgccgcgaag atcctggacg ccgcgcgcaa gaccggcgcg       240
     gacgccgtcc accccggcta cggcttcctg tcggagaacg ccggcttcgc cgaggcgtgc       300
     gcgcaggccg ggatcgtctt cgtcggaccg tccccggacg cgatccgcaa gatgggcatc       360
     aagcacgagg cgaaggcgat cgcgaaggcc gccggcgtgc cggtgctgcc cgacgcgctg       420
     ctgaccaccg acgagccgga cgattggcgc cggtcctccg aaggcgtcgg attcccgttg       480
     ctggtgaagg cttccgccgg cggcggcggc aagggcatgc ggctggtctc ctccgtggag       540
     gagctcgaga acgcggtctc cggagcccgg cgcgaggcgg cggcggcgtt cggcgacggg       600
     acggtgttcc tggagcgcta cctcgccgcc tcccggcaca tcgagatcca ggtcttcggc       660
     gacacgcacg gcaacgccgt gttctacggc gagcgcgaat gctcggtgca gcggcgccac       720
     cagaaggtcg tcgaggaggc gccgtcctcc gcggtcggcg cggcggtgcg ggccaagatg       780
     ggcgaggtcg cgtgcgcgct ggtgcgcgag ctggggtacg tcggcgccgg gaccgtggag       840
     ttcctgttcg acgacacgga cgactcctac tacttcctcg agatgaacac ccggctgcag       900
     gtcgagcacc cggtcaccga ggaggtctgg gggcaggacc tggtccggcg gcagttcgag       960
     gtcgccgccg gcgcggtgct caccgctccg gacccggaag ccttgcacgg ccacgcgatc      1020
     gaggtgcgtc tctacgccga ggacccggcg cgcaagtaca tcccgtcgcc cggcacgctg      1080
     gctctgtatg agcacgctga cgtacccggg atccggtacg aggacggcgt ccgcagcggc      1140
     agcgtcgtct cgcactacta cgacccgatg ctgtccaagg tggtcgcgac cggcctcacc      1200
     cgcggcgagg cggcgttgaa gctggcgtcg gcgctcgccg ggatgcgcat ccaagggctg      1260
     aagaccaacc gggaccagct cgtggcgatc ctgcgcgacc ccgacttcct ggccgggacc      1320
     acgcggaccg acttcctgga cctgcatccc gcgttggcgg cgcccgagga ccggaccgac      1380
     gtcaccgcgc acctcgcggc ggcgctcgcg gtgtcggtgc accggcggcg ttcggccggc      1440
     ggcgcgaccg cgttcgctcc ggccggctgg cggctgctgc cctacgacgg cgccaacgcg      1500
     gcgtggacgc ggcaagacgt acggagagcg ccggaaaccc ctattacgta ccgtttcgac      1560
     agctcaacgt tgtacctgat ccacggcgga gccgagtacg aggtttccct gagggatctg      1620
     ggccctgact cggtgcgcgt ggcggtggac ggcgtcgacc ggctgtgccg ggtgcgggtc      1680
     gccgaggaca ccgtggtgtg ggtcgacgac agcgacggcg ggcactccgc ctggaagccg      1740
     acgccgcgtt tcccggagga cgccgacgcc ttcgcggccg acgacggtgc cgctgaagtg      1800
     cccggaaccg tggtggcgat ctccgtggcc gccggggacc gggtcaaggc cgggcaggtg      1860
     ctggtgagca tggaggccat gaagatggaa caccaggtga aggccgggcg cgacggcgtc      1920
     gtcggttcgg tggactgcgc cgtggggcaa ttcgtggacg cgcatcaggt tttggtgacg      1980
     ctgacctga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page