(data stored in ACNUC7421 zone)

EMBL: CP001700.PE165

CP001700.PE165       Location/Qualifiers
FT   CDS_pept        177622..178383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0165"
FT                   /product="acyl-CoA synthase"
FT                   /note="KEGG: mav:MAV_3523 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69120"
FT                   /db_xref="GOA:C7QHI1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI1"
FT                   /inference="similar to AA sequence:KEGG:MAV_3523"
FT                   /protein_id="ACU69120.1"
FT                   /translation="MPATQSTETRDPVEFHWLGDIVRVNLDGNTHGSVLAYGAQEWDWT
FT                   EFDSRIRKCVTGIRSDRLQRGQRVAVLARNHPVHFETLFAASNMGLVCTWLDWRLDRAH
FT                   VVHALNESEARILFVGEEFLDLVEDSMMEISSVVSTITVGGPEDEYEEWLETHETHEAL
FT                   LRAAREVAASSGRGDEPVLRLYSSTGKKGPTRGEYTHRALLTSAVEILRRKSLTRGDVE
FT                   AVDAPVTVHEAAVRVLANMSAGAATVLVQEE"
     atgcctgcca cgcaaagtac tgagacgcgc gatccggtgg aattccactg gctcggcgac        60
     atcgtgcgtg tgaacctcga cggaaacacg cacggttccg tcctggccta cggagcccag       120
     gagtgggact ggaccgagtt cgactcccgg atccgcaagt gcgtgaccgg gatccgcagc       180
     gaccggctcc agcgcggcca gcgcgtggcc gtgctcgccc gcaaccaccc ggtccacttc       240
     gagaccctgt tcgcggccag caacatgggc ctggtctgca cctggctgga ctggcgcctg       300
     gaccgcgcgc acgtggtcca cgccctgaac gagtccgagg cccgcatcct gttcgtcggc       360
     gaggagttcc tggacctcgt cgaggactcc atgatggaga tctcctcggt ggtcagcacc       420
     atcaccgtcg gcggtcccga ggacgagtac gaggagtggc tggagaccca cgagacccac       480
     gaagccctcc tgcgcgccgc ccgcgaggtg gccgccagct ccggccgcgg cgacgaaccg       540
     gtcctgaggc tctactcctc gaccggcaag aagggcccga cccgcggcga gtacacccac       600
     cgcgccctgc tgacctcggc cgtggagatc ctgcgccgca agtccctgac ccgtggcgac       660
     gtcgaggcag tggacgcccc ggtgacggtg cacgaggccg ccgtgcgcgt gctggcgaac       720
     atgtcggcgg gcgctgcgac agtgttggtg caggaggagt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page