(data stored in ACNUC7421 zone)

EMBL: CP001700.PE166

CP001700.PE166       Location/Qualifiers
FT   CDS_pept        complement(178394..179059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0166"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_4377
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69121"
FT                   /db_xref="GOA:C7QHI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69121.1"
FT                   /translation="MSGKERREQLIEIGRTLFAERGFDATSVEEIATKAGVSKPVVYEH
FT                   FGGKEGLYAVVVDREMAKLLSMVTSGLTGEHARELLEQAAFALLDYIESSTDGFRILVR
FT                   DSPVTTSTGNFASLISDIASQVEDLLGVHFMHRGYDPKLAPMYAQMLVGMVALTGQWWL
FT                   DVRKPPKAEVAAHLVNLAWNGLSHLEGQPRLIVQEQAEAKVRRAARKTERAARADAKR"
     atgagcggca aggaacggcg ggagcagctc atcgagatcg gccggaccct gttcgccgag        60
     cgcggcttcg acgccacctc ggtggaggag atcgcgacca aggccggcgt ctccaagccg       120
     gtcgtctacg agcacttcgg cggcaaggaa ggcctctacg cggtcgtggt ggaccgcgag       180
     atggccaagc tcctgtccat ggtgaccagc ggcctcaccg gcgaacacgc ccgcgaactc       240
     ctggagcagg cagccttcgc cctgctggac tacatcgagt ccagcaccga cggcttccgc       300
     atcctggtcc gcgactcccc ggtcaccacc tccaccggca acttcgcctc cctgatctcc       360
     gacatcgcct cccaggtcga agacctcctg ggcgtccact tcatgcaccg cggctacgac       420
     cccaagctcg cgcccatgta cgcgcagatg ctcgtcggca tggtcgccct caccggccag       480
     tggtggctcg acgtccgcaa accccccaag gccgaggtcg ccgcacacct ggtgaacctg       540
     gcctggaacg gcttgtcgca cttagagggc cagccccgcc tgatcgtgca ggagcaggcc       600
     gaggcgaagg tccggcgggc ggcgcggaag acggagcgcg ccgcgcgggc tgacgccaag       660
     cggtag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page