(data stored in ACNUC7421 zone)

EMBL: CP001700.PE167

CP001700.PE167       Location/Qualifiers
FT   CDS_pept        complement(179179..180144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0167"
FT                   /product="Stearoyl-CoA 9-desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="PFAM: fatty acid desaturase; KEGG: sgr:SGR_4378
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69122"
FT                   /db_xref="GOA:C7QHI3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI3"
FT                   /inference="protein motif:PRIAM:1.14.19.1"
FT                   /protein_id="ACU69122.1"
FT                   /translation="MTQTSVPQQQPTAPATVRGTRGGETQSFKERIALSFVIGVPFAAL
FT                   VIAVPVVWGWGMTWTDLIIAVVMYAISGHGVTVGFHRLFTHSSFKAKKALRVGLAIAGS
FT                   LAVQGPVIRWVADHRKHHRYSDHDGDPHSPWRYGETLPALMKGLWHAHIGWLYNAEQTN
FT                   QQQYAPDLLKDRAIVRVSRAFPYLVLVSLLLPAAVGGLVTWSWQGILTAFFWGSLVRIA
FT                   LLHHTTWSINSICHAVGERPFRSRDRSGNVWWLAVLSMGESWHNLHHSDPTAARHGVLR
FT                   GQIDSSARIIWLFEKFGWVRDVRWPSRERVALKLRGEAAP"
     atgacacaaa cctcggttcc gcagcagcag cccaccgccc ccgccacggt ccgaggaacc        60
     cgcgggggcg agacccagtc cttcaaggag cgcatcgccc tcagcttcgt catcggcgtg       120
     cccttcgccg ccctggtgat cgccgtcccc gtggtctggg ggtggggcat gacatggacc       180
     gatctgatca tcgcggtggt gatgtacgcc atcagcggcc acggcgtgac ggtcggcttc       240
     caccgcctgt tcacccattc ctccttcaag gccaagaagg cactgcgggt gggtctggcg       300
     atcgccggct cgctggcggt ccagggcccg gtgatccgct gggtcgccga ccaccgcaag       360
     caccaccgct acagcgacca cgacggcgat ccgcactcgc cgtggcgcta cggcgagacg       420
     ctcccggccc tgatgaaggg cctgtggcac gcgcacatcg gctggctgta caacgccgag       480
     cagaccaacc agcagcagta cgccccggac ctgctgaagg accgggcgat cgtgcgcgtc       540
     tcgcgcgcct tcccctacct ggtgctggtc tccctgctgc tgccggcggc cgtcggcggg       600
     ctggtgacct ggagctggca ggggatactg accgccttct tctggggctc gctggtccgc       660
     atcgcgctgc tgcaccacac gacctggtcg atcaactcga tctgccacgc cgtcggcgag       720
     cgcccgttcc gctcccgcga ccgctccggc aacgtctggt ggctggcggt gctctccatg       780
     ggcgagtcct ggcacaacct gcaccactcg gacccgaccg cggcccgcca cggcgtgctg       840
     cgcgggcaga tcgactcctc ggcgcggatc atctggctgt tcgagaagtt cgggtgggtc       900
     cgggatgtgc ggtggccttc ccgggagcgg gtcgccttga aattgcgcgg tgaagccgct       960
     ccataa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page