(data stored in ACNUC7421 zone)

EMBL: CP001700.PE168

CP001700.PE168       Location/Qualifiers
FT   CDS_pept        180559..182085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0168"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; KEGG: sco:SCO3122
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69123"
FT                   /db_xref="GOA:C7QHI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI4"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACU69123.1"
FT                   /translation="MTDQHAPTVIILAAGEGKRMKSATPKVLHELCGRTMLGHVVAAAQ
FT                   DLAPSRLAVVVGKGRDLVAPHVAAIAPEARIVVQEPQNGTGQAARLALEALVAEGGPAE
FT                   GTVLVLLGDGAMVTGGTLRHLIAVHESSGNAVTDLTAVVPDPRGLGRILREPDGTAEGR
FT                   VLGIVEEKDCTPAQATIPEINSGIFAFDGKLLRDALSRLTTDNAQGEELLTDVLAIAVG
FT                   DGLPVGAVVAADYHEVLAANDRAQLADLRRLMNQRITRQWMLEGVTIVDPATTWIDVHA
FT                   TLEPDATIRPNTQLEGATRIAAGADVGPNCTLRDTVVGERARVTNATTDGAEIGPEASV
FT                   GPYTYLRPGTKLGRKSKAGGFVEMKKSTIGEGTKVPHLAYIGDATIGAGTNIGAGVITA
FT                   NYDGYNKFPTRIGDHAFVGTNTTLIAPAEVADGAYIAAGSAVNMPVGPGELAVARGRQR
FT                   NIAGYVARKRPDSVAAQAAARAAERAAAGGQPAVETNPTGGGPGAQADAV"
     atgaccgacc agcacgcgcc gaccgtcatc atcctggccg ccggcgaggg caagcggatg        60
     aaatccgcga cgccgaaggt gctgcacgag ctgtgcgggc gcaccatgct cggccacgtg       120
     gtggccgcgg cgcaggacct ggcgcccagc cggctcgcgg tggtcgtggg caagggccgg       180
     gacctggtcg cgccgcacgt cgcggcgatc gcgccggagg cccggatcgt cgtgcaggag       240
     ccgcagaacg ggaccgggca ggccgcgcgg ctggcgctgg aggccctggt cgccgagggc       300
     ggcccggccg agggcacggt gctggtgctg ctcggcgacg gcgccatggt caccggcggc       360
     acgctgcgcc acctgatcgc cgtgcacgaa agttccggca acgccgtcac cgacctgacc       420
     gcggtcgtgc cggacccgcg cggcctgggc cgcatcctgc gcgagccgga cggcacggcc       480
     gagggccggg tcctgggcat cgtggaggag aaggactgca cgccggcgca ggccaccatc       540
     cccgagatca actccggcat cttcgccttc gacggcaagc tcctgcgcga cgcgctcagc       600
     cggctcacca ccgacaacgc gcagggcgag gagctgctca ccgacgtgct ggcgatcgcc       660
     gtcggcgacg gcctgccggt cggcgccgtg gtcgccgcgg actaccacga ggtgctggcc       720
     gccaacgacc gcgcgcagct ggccgacctg cggcggctga tgaaccagcg gatcacccgc       780
     cagtggatgc tcgagggcgt caccatcgtg gacccggcga ccacctggat cgacgtgcac       840
     gccaccttgg agccggacgc cacgatccgt cccaacaccc agctggaggg cgcgacccgg       900
     atcgccgccg gggcggacgt cggcccgaac tgcacgctga gggacaccgt cgtcggcgag       960
     cgcgcgcggg tcaccaacgc caccaccgac ggcgccgaga tcggcccgga ggccagcgtc      1020
     gggccgtaca cctatctgcg cccgggcacc aagctcggcc gcaagtccaa ggccggcggc      1080
     ttcgtggaga tgaagaagtc gacgatcggc gagggcacga aggtcccgca cctggcctac      1140
     atcggcgacg ccacgatcgg cgcgggcacc aacatcggcg ccggcgtcat caccgccaac      1200
     tacgacggct acaacaagtt cccgacccgc atcggcgacc acgccttcgt cgggaccaac      1260
     accaccctga tcgccccggc ggaggtcgcc gacggcgcgt acatcgccgc ggggtcggcg      1320
     gtgaacatgc cggtgggtcc cggcgaactg gcggtggcgc gcggccggca gcgcaacatc      1380
     gccgggtacg tcgcgcgcaa gcgcccggac tcggtggcgg cgcaggccgc cgcgcgtgcc      1440
     gccgagcgcg ccgcggccgg cgggcagcca gccgttgaga cgaatcccac aggcggcggc      1500
     cctggcgcgc aggcggacgc ggtctga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page