(data stored in ACNUC7421 zone)

EMBL: CP001700.PE169

CP001700.PE169       Location/Qualifiers
FT   CDS_pept        182148..183128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0169"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: sgr:SGR_4383 putative ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69124"
FT                   /db_xref="GOA:C7QHI5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACU69124.1"
FT                   /translation="MTGLKTTGEKKLMLFTGRAYPELAQEVAEELGVEIAPMKAHDFAN
FT                   GEIYTRFEESVRGSDAFVIQCHSAPINHSIMEQLIMVDALKRASSKRITVITPFYGYAR
FT                   QDKKHKGREPISARLMADFFATAGADRLMAVDLHTDQIQGYFDGPVDHLFALPVLVDYI
FT                   KGKYDTSKLTVVSPDAGRVRTADRWTDRLNTPLAIVHKRRDPNIPNTVSVHEIVGEVKG
FT                   RTCVLVDDMVDTAGTICAAAEALFENGAAEVIIAATHAVLSDPATDRLKNSRISEVIFT
FT                   NTLPIPDEKRFDKMTVLSIAPMLARAIREVFEDGSVTSMFDDHKH"
     gtgaccggcc tcaagaccac cggtgagaag aagctcatgc ttttcaccgg acgcgcctat        60
     cccgagctgg cccaggaagt cgccgaagag ctgggggtcg agatcgcccc catgaaggca       120
     cacgacttcg ccaacggcga gatctacacc cgtttcgagg agtcggtgcg cggcagcgac       180
     gccttcgtga tccagtgcca ctccgcgccg atcaaccact ccatcatgga gcagctgatc       240
     atggtggacg cgctgaagcg ggcctcctcc aagcggatca ccgtcatcac gcccttctac       300
     ggctacgcgc gccaggacaa gaagcacaag ggccgcgagc cgatctcggc gcgtctgatg       360
     gccgacttct tcgccaccgc cggcgccgac cggctgatgg cggtggacct gcacaccgac       420
     cagatccagg gctacttcga cggcccggtg gaccacctgt tcgcgctgcc ggtgctggtg       480
     gactacatca agggcaagta cgacacctcc aagctcacgg tggtctcccc cgacgccggc       540
     cgggtgcgca ccgccgaccg ctggaccgac cgcctgaaca cgccgctggc gatcgtgcac       600
     aagcgccgcg accccaacat cccgaacacg gtctcggtcc acgagatcgt cggcgaggtc       660
     aagggccgca cctgcgtact ggtcgacgac atggtcgaca ccgccggcac catctgcgcc       720
     gccgccgagg cgctgttcga gaacggcgcc gccgaggtca tcatcgccgc gacgcacgcg       780
     gtgctctccg acccggcgac cgaccggctg aagaactcgc ggatcagcga ggtgatcttc       840
     accaacacgc tgccgatccc ggacgagaag cggttcgaca agatgacggt gctgtcgatc       900
     gcgccgatgc tggcccgggc gatccgcgag gtgttcgagg acggctcggt cacgtcgatg       960
     ttcgacgacc acaagcactg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page