(data stored in ACNUC7421 zone)

EMBL: CP001700.PE17

CP001700.PE17        Location/Qualifiers
FT   CDS_pept        19091..19840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68972"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN3"
FT                   /inference="similar to AA sequence:KEGG:SGR_419"
FT                   /protein_id="ACU68972.1"
FT                   /translation="MDRDPLPDARALVRERYPQAVYAVLAGSVLTAHRTPGSDLDIVVA
FT                   LPPGDPLAPRRESLVFRDWPVELFVHDEQTLDQWLAKEYRERKPSLYRMVGRGTPIVGD
FT                   PADRQAYCRAVLDAGPDPMGPAQLEAARYGLTDLLDDLFHAGDPGERQVIAATLWTAAG
FT                   HHALVAGNRWDGTGKWLLRELRDHDPDLADRWLAAQHDAAAVEAFARDVLDRLGGPLFD
FT                   GYQAVAPRAETTKTTKTTKTTEFTRST"
     atggaccgtg atccgcttcc cgacgcccga gccctggtgc gcgaacgtta tccccaggct        60
     gtgtacgccg tgctggccgg cagtgtcctg accgcgcacc gaacgcccgg ctcggatctc       120
     gacatcgtcg tggcactccc acccggcgat ccgctggcgc cgcgccgcga gtcgctcgtc       180
     ttccgcgact ggccggtcga gctgttcgtg cacgacgagc agaccctcga ccagtggctg       240
     gccaaggagt atcgcgagcg caagccgagc ctgtaccgga tggtcggccg cggaacaccg       300
     atcgtcggcg acccggccga ccggcaggca tattgccgcg cggtcctgga cgccgggccg       360
     gatccgatgg gaccggcaca gctggaagcg gcgcgctacg gcctcaccga tctgctcgac       420
     gatctcttcc acgccggcga tcccggcgag cgccaggtca tcgcggccac gctgtggacc       480
     gccgccgggc atcacgcgct ggtcgccgga aaccgctggg acggcaccgg caaatggctg       540
     ctccgcgagt tgcgcgacca cgacccggac ctggccgacc gctggctggc cgcccagcac       600
     gacgcggccg cggtcgaggc gttcgcccgc gacgtcctgg accgtctcgg cggaccgctt       660
     ttcgacggct accaggctgt cgcgccgcga gcggagacca cgaagaccac gaagaccacg       720
     aagaccacag agttcacccg gtccacctag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page