(data stored in ACNUC7421 zone)

EMBL: CP001700.PE170

CP001700.PE170       Location/Qualifiers
FT   CDS_pept        183392..184015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0170"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   tfu:Tfu_0416 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69125"
FT                   /db_xref="GOA:C7QHI6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI6"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACU69125.1"
FT                   /translation="MSQIRISAEDRTEFGKGFARRARAVNKVPAVVYGHGEPVRHILLP
FT                   GHDLMIALRTPNVLLNLEFGDGKAQLVLPKDVQKDPVKRTLEHVDLVLVRSGEKVTVDI
FT                   PITVTGEVVGGAVLDHSLNNLTVTAEATHIPTGIEVDVDRKEEGFQLFVRDLELPAGSE
FT                   LVTDGDQLVLQVVVTRAEVSEEAAEGEGDAEGEAAEGASEESAE"
     atgtcccaga tccgcataag cgcagaggac cgcaccgagt tcggcaaggg cttcgcccgc        60
     cgcgcccgtg ccgtgaacaa ggtccccgcc gtcgtctacg gccacggcga gccggtgcgc       120
     cacatcctgc ttccgggcca cgacctgatg atcgcgctgc ggaccccgaa cgtgctgctg       180
     aacctggagt tcggcgacgg caaggcccag ctggtgctgc cgaaggacgt gcagaaggac       240
     ccggtcaagc gcaccctgga gcacgtggac ctggtgctgg tgcgcagcgg cgagaaggtc       300
     accgtcgaca tcccgatcac cgtcaccggc gaggtcgtgg gcggcgcggt gctggaccac       360
     tcgctgaaca acctgaccgt gaccgccgag gccacgcaca tcccgaccgg catcgaggtc       420
     gacgtggacc gcaaggagga gggcttccag ctcttcgtcc gcgacctgga gctgccggcc       480
     ggctccgagc tggtcaccga cggcgaccag ctggtcctgc aggtcgtcgt gacccgcgcc       540
     gaggtctccg aggaggccgc cgagggtgag ggcgacgccg agggcgaggc cgccgagggc       600
     gcgtccgagg agtcggcgga gtag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page