(data stored in ACNUC7421 zone)

EMBL: CP001700.PE171

CP001700.PE171       Location/Qualifiers
FT   CDS_pept        184044..184640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0171"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: sco:SCO3125 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69126"
FT                   /db_xref="GOA:C7QHI7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI7"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACU69126.1"
FT                   /translation="MTTTEARDQLWLIAGLGNPGPGYAGNRHNAGFMVVDLLAARVGGK
FT                   FKSHKARADVVEGRLGVGGPRVVLAKPKTFMNLSGGPVKALRDFYKIEPAQIIAVHDEL
FT                   DVDYGVLRLKLGGGDNGHNGLRSITSSLGTKEYHRVRFGVGRPPGRQDPADFVLKDFSS
FT                   TEKKDLDYNVDRAADAVEDLIRRGLVEAQNIYHAA"
     atgaccacca ccgaggcccg cgaccagctc tggctgatcg cgggcctcgg caatcccggg        60
     cccgggtacg ccggcaaccg gcacaacgcc ggcttcatgg tcgtggacct gctcgccgcg       120
     cgcgtcggcg gcaagttcaa gtcgcacaag gcgcgggcgg acgtcgtgga gggccggctc       180
     ggggtcggcg gaccgcgcgt ggtcctggcc aagccgaaga ccttcatgaa cctgtccggc       240
     ggcccggtga aggcgctgcg cgacttctac aagatcgagc cggcgcagat catcgccgtg       300
     cacgacgaac tcgacgtgga ctacggcgtg ctgcgcctga agctcggcgg cggcgacaac       360
     ggccacaacg ggctgcgctc gatcacctcc tcgctgggga ccaaggaata ccaccgcgtg       420
     cgcttcggtg tcggacggcc gccggggcgg caggatccgg cggacttcgt cctgaaggac       480
     ttctcctcga ccgagaagaa ggacctggac tacaacgtgg accgggccgc cgacgcggtc       540
     gaggacctga tccgccgcgg gctcgtcgag gcgcagaaca tctaccacgc ggcctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page