(data stored in ACNUC7421 zone)

EMBL: CP001700.PE172

CP001700.PE172       Location/Qualifiers
FT   CDS_pept        184839..185807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0172"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5452 ABC transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69127"
FT                   /db_xref="GOA:C7QHI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69127.1"
FT                   /translation="MPAIEVRGLRKAYGDVTAVEDVSFEVAEGEIFGILGPNGAGKTTT
FT                   VECVSGLRTPDAGEVRVLGLDPRRDREDVRQVLGVQLQESQLPGKIHVREALELYASFY
FT                   RDPADVDRLLAQWELTEKAGARFGKLSGGQKQRLAVALAMVGKPRVVVLDELTTGLDPH
FT                   ARRTAWEMVQAVRDSGVTVLLVTHFMEEAERLCDRVAIIDAGRVVALDTPAAMAARGPA
FT                   AGQRMRFRPSAPVEDADLLALPEVRSVERHGAHLEVSGTSEVIGAVTAYLARRQIIAAE
FT                   LRVEQSSLDDAFIALTTHATTTTHAAQTMQTAQTAQTAKES"
     atgccagcga tcgaggtgcg cggcctgcgg aaggcctacg gcgacgtaac cgccgtggag        60
     gacgtctcgt tcgaggtcgc cgaaggggag atcttcggga tcctcgggcc caacggcgcc       120
     gggaagacca cgaccgtgga gtgtgtcagc ggtctgcgga cgcccgacgc cggcgaggtc       180
     cgcgtgctgg gtctggaccc gcggcgcgat cgtgaggacg tccgccaggt gctcggcgtg       240
     cagctgcagg agagccagct gccgggcaag atccatgtgc gcgaggcgct ggagctgtac       300
     gcgtcctttt accgggaccc ggccgacgtg gaccggctgc tggcgcagtg ggagctgacg       360
     gagaaggccg gcgcccgctt cggcaagctg tccggcggcc agaagcagcg gctggccgtg       420
     gcgctggcga tggtcggcaa gccgcgggtg gtcgtgctgg acgagctgac caccggtctg       480
     gacccgcacg cgcggcgcac cgcctgggag atggtccagg ccgtccggga ctccggcgtc       540
     accgtcctgc tggtcacgca cttcatggaa gaggccgagc ggctctgcga ccgggtcgcg       600
     atcatcgacg ccggccgcgt ggtcgccctg gacaccccgg ccgcgatggc cgcgcggggt       660
     ccggcagccg gccagcggat gcggttccgg ccctcggcgc cggtcgagga cgcggacctg       720
     ctcgcgttgc ccgaggtccg cagcgtcgag cggcacggcg cgcatctgga agtgagcggg       780
     acctcggaag tcatcggggc ggtcaccgcg tacctcgcgc ggcgccagat catcgccgcc       840
     gagctgcgcg tcgagcagag cagcctcgac gacgcgttca tcgcgttgac gacgcacgcg       900
     accaccacga cccatgccgc gcagaccatg cagacggcgc agaccgcgca gaccgccaag       960
     gagtcctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page