(data stored in ACNUC7421 zone)

EMBL: CP001700.PE173

CP001700.PE173       Location/Qualifiers
FT   CDS_pept        185807..186595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0173"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sgr:SGR_876
FT                   putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69128"
FT                   /db_xref="GOA:C7QHI9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69128.1"
FT                   /translation="MSTATFSSRSSRLLPEFRMTGNGFRTLVRTQARLLWREPAVVLSG
FT                   IALPVLLIIVFGCIPSFGKPAASLGGRTTMDVYVPTFAMLSSVLTALTALPVTFADLRE
FT                   RGVLRRLAVSPVPAAGLLAAQVTVIATTAAVTAASVVLIGVAGFGASLPAHLALVLASY
FT                   ILGTTALLAIGLLIAALAPSAGVATGFGVPTMILNFFFAGVYVPLQQLPSVLRTASGFV
FT                   PYGAIVDTWSGTGAAWQHLTVLAVYTVVGALAAARVFKWE"
     atgagcaccg cgaccttctc ttcccgctcc tcccgtctgc tgcccgaatt ccggatgacc        60
     ggcaacgggt tccgcaccct ggtgcgcacc caggcccggc tgctgtggcg ggaaccggcg       120
     gtggtgttgt cgggaatcgc cttgccggtc ctgctgatca tcgtcttcgg ctgcatccct       180
     tcgttcggga agccggcggc ctcgctcggc ggcaggacga cgatggacgt ctacgtcccg       240
     accttcgcga tgctctcctc ggtgctgacc gccctcaccg ctctgccggt gaccttcgcg       300
     gacctgcggg agcggggcgt gctgcggcgt ctggcggtct cgccggtccc tgccgccggg       360
     ctgctcgcgg cacaggtgac ggtgatcgcc acgaccgccg cggtgacggc ggcctcggtg       420
     gtgctgatcg gcgtggccgg gttcggcgcc tcgctgccgg cgcacctggc gctggtgctg       480
     gcgtcctaca tcctggggac caccgcgctg ctggcgatcg ggctgctgat cgcggcgctc       540
     gcgccgtcgg ccggggtggc gaccgggttc ggtgtgccta cgatgatcct gaacttcttc       600
     ttcgcgggcg tctacgtccc gctccagcag ctgccctcgg tgctgcgcac ggccagcggg       660
     ttcgtgccgt acggcgcgat cgtggacacc tggtccggca ccggcgcggc gtggcagcat       720
     ctgacggtgc tcgcggtgta caccgtcgtc ggcgcgctgg ctgcggcccg cgtgttcaag       780
     tgggaatag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page