(data stored in ACNUC7421 zone)

EMBL: CP001700.PE174

CP001700.PE174       Location/Qualifiers
FT   CDS_pept        186609..187907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0174"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sco:SCO5454 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69129"
FT                   /db_xref="GOA:C7QHJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69129.1"
FT                   /translation="MVESATVQRWIPYAGLAVSLTLALIIGPRTGVYYTVVLGGSAAAA
FT                   LWVRRGRALLDAPNPPVLRATVYYAVLLALLATLILTSPLFGFFGFTGYLHAMVLPGRT
FT                   KLFGIAGTAGAMATTQMGGIVNIHGAGVYLYLVLVAVNLLIAGTLTVTGAAEEEHRREL
FT                   AEANERLHEMLEENAGLHAQLVAQAREAGVLDERQRLAGEIHDTIAQGLTGIVRQLEVV
FT                   ERFDDDVERRKHHLTLARELARESLAEARRSVQALRPGPLAVAQLPEALAELAASWSRT
FT                   AGIEARVEVSGEAVALSPEVEVALFRAAQEALANAGKYSGAGRVGVTVSYTSDVVVLDV
FT                   VDDGAGFDPEEVRRRGADSASENGTGYGLSAMRSRLRQVGGTLTIESEPGDGTAISAAV
FT                   PLVTLAAETASAGASARASTGAVAEAVTEAVTG"
     gtggtggaat cggcgacggt ccagcggtgg atcccgtacg cgggcctggc ggtctccctg        60
     actctggccc tcatcatcgg tccccggacc ggggtgtact acaccgtggt cctcgggggc       120
     tccgcggctg cggcgctgtg ggtccggcgc gggcgggcgc tgctggacgc gccgaacccg       180
     ccggtgctgc gcgcgacggt ctactacgcg gtcctgctgg cgctgctcgc gacgctgatc       240
     ctgaccagcc cgctgttcgg cttcttcggc ttcaccggct acctgcacgc gatggtcttg       300
     ccgggacgga ccaagctctt cgggatcgcg ggaaccgccg gcgccatggc gaccacgcag       360
     atgggcggca tcgtcaacat ccacggcgcc ggcgtctatc tctacctggt gctggtcgcg       420
     gtcaacctgc tcatcgccgg cacgttgacg gtcaccggcg cggccgagga ggagcaccgg       480
     cgcgagctgg ccgaggcgaa cgagcggctg cacgagatgc tcgaggagaa cgcgggactg       540
     cacgcgcagt tggtcgcgca ggctcgggag gccggggtgc tcgacgaacg ccagcggctc       600
     gcgggggaga tccacgacac catcgcgcag ggactcacgg ggatcgtgcg gcagctggag       660
     gtcgtggagc ggttcgacga cgacgtggag cgccggaagc atcacctgac gctggcccgg       720
     gaactggcgc gcgagagcct ggccgaggca cgccggtcgg tccaggcgct gcggccggga       780
     ccgctggccg tggcgcagct gccggaggcg ctggcggagc tggcggcgtc gtggtcgcgg       840
     acggcgggga tcgaggcgcg ggtggaggtt tccggggagg ctgtcgcgct ctcgccggag       900
     gtggaggtgg cgctgttccg ggcggcgcag gaagcgttgg ccaacgccgg gaagtattcg       960
     ggggcggggc gtgtgggggt cacggtgtcc tacacgagcg atgtcgtggt tctggacgtg      1020
     gtggacgacg gcgcggggtt cgaccccgaa gaggtgcgga ggcgtggcgc cgacagcgcg      1080
     tcggagaacg ggacgggcta cggattgagc gcgatgcggt cgcggcttcg gcaggtcggc      1140
     gggacgctca ctatcgagag cgagcctggg gacggcacag ccatcagcgc cgcggtgccc      1200
     ttggtgacgc tggcggcgga gacggcttcg gcgggggcga gcgcgagagc gagcaccgga      1260
     gccgtggcgg aggcggtgac ggaggcggtg acggggtga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page