(data stored in ACNUC7421 zone)

EMBL: CP001700.PE175

CP001700.PE175       Location/Qualifiers
FT   CDS_pept        187936..188604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0175"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: sco:SCO5455 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69130"
FT                   /db_xref="GOA:C7QHJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69130.1"
FT                   /translation="MIDRVSGDSSPLRLLIVDDHPIVRDGLRGVFDGEDGFEVVGEASD
FT                   GAQALVRAAESGPDVVLMDLRMPTMGGVEAIRRLRVEQPAVRVLVLTTYDTESDVLPAI
FT                   EAGATGYLLKDAPREDLIRAVRAAAAGQPVLAPTVAQRLMTRVQTPLAEPAPPGDALTE
FT                   RELEVLRLVASGTTNRETARKLFISEATVKTHLLHAYAKFGVRDRAAAVAEAYKRGLLK
FT                   "
     atgattgatc gcgtgtccgg tgattcgagt cctctccgcc tgctgatcgt ggacgaccat        60
     ccgatcgtcc gcgacgggct gcgcggcgtc ttcgacggcg aggacggctt cgaggtcgtc       120
     ggcgaggctt ccgatggcgc gcaggctttg gtgcgggcgg cagagtcggg acccgacgtg       180
     gtcctgatgg acctgcgcat gccgacgatg ggtggcgtcg aggcgattag gcggctgcgg       240
     gtggagcagc cggctgtcag ggtcctggta ctcacgacct atgacaccga gtccgatgtg       300
     ctgcccgcga tcgaggccgg tgcgaccggc tatctgttga aggacgcgcc gcgcgaggat       360
     ctcatccggg ccgttcgggc tgcggcggcg gggcagccgg tcctggcgcc gactgtggcg       420
     cagcggctga tgactcgcgt tcagacgcct ctggcggagc ccgcgccgcc cggtgacgcg       480
     ctgaccgagc gggagttgga agttcttcgg ctcgtcgcct ccggcaccac caaccgcgag       540
     accgcgcgca agctgttcat cagtgaggcc acggtcaaga cgcatctgct gcacgcctac       600
     gccaagttcg gcgttcgcga ccgcgccgcg gcggtcgccg aagcctataa gcgcggcttg       660
     ctgaagtag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page