(data stored in ACNUC7421 zone)

EMBL: CP001700.PE176

CP001700.PE176       Location/Qualifiers
FT   CDS_pept        complement(188628..188966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0176"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   mlo:mll3541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69131"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ2"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ACU69131.1"
FT                   /translation="MTAYALAHVRSVELCADIVEYLERIQGTMDPFGGRFAFHGGEKEV
FT                   VEGAWTGDLILIEFPTLDAVHSWWTSPEYRAIKNLRTDHMAADIVVFDTLPADYNVGAT
FT                   AAKLAKLL"
     atgaccgcct acgcactcgc ccacgtccgt tccgtcgagc tctgcgccga catcgtggag        60
     tacctggagc gtatccaggg caccatggac cccttcggcg gccgcttcgc cttccacggg       120
     ggtgagaagg aagtcgtaga aggcgcctgg acgggcgacc tcatcctcat cgagttcccc       180
     accctggacg cagtccacag ctggtggaca tcgccggaat accgggccat caaaaacctg       240
     cggaccgacc acatggcggc cgacatcgtg gtcttcgaca ccctgccggc ggactacaac       300
     gtcggggcga ccgccgcgaa gctggcgaag ctcctctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page