(data stored in ACNUC7421 zone)

EMBL: CP001700.PE178

CP001700.PE178       Location/Qualifiers
FT   CDS_pept        complement(189512..192334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0178"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   sco:SCO3127 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69133"
FT                   /db_xref="GOA:C7QHJ4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ4"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACU69133.1"
FT                   /translation="MSAVPSPKNDDAAVETPTDSPTARANDTANDNPPRTADDAELRAA
FT                   IRRLGDLLGQTLVRQHGPELLEQVEAIRALGKQGADVSELLAAVDPEQAIKLVRAFTAY
FT                   FNLANTAEQVHRGRELAATRAAEGSWLGQAVDRIQAAGLAGTAAEAVSHLSVRPVFTAH
FT                   PTEAARRTVLAKLRKVAELLEAPQTAYNERRLAETVEQLWQTDEIRITRPEPVDEARNA
FT                   VYYLDELAAHAAPEVLEELAVELRRLGVELPLSARPLSFGSWIGGDRDGNPNVTPQMTL
FT                   DVLELQHEHAIRTALASMDALREILSTSERIAAPTEALRASLDADLEALPEIPNRYRRL
FT                   NAEEPYRLKATTIRQKLLNTRTRIAEGRQHDPRRDYLGTSELLRDLSLMRDSLYADRGE
FT                   LIATGELETAIRTIAAFGLHHAVLDVREHADAHHHVLAQLFDRLGDQPWRYSDLPRDYR
FT                   TRLLAKELASSRPLSALGQVPADTLLDAAGVKSFGVFTAIRTAFEKYGPDVIESYIVSM
FT                   TRGVDDLFAAVVLAREAGLVDVHAHTAAIGFVPLLETPDELKIAGSILDEMLSDPSYAA
FT                   IVAARGGVQEVMLGYSDSNKMGGISTSQWEIHRAQRELRDTALRHGIRIRLFHGRGGSV
FT                   GRGGGPSHDAILAQPWGTLDGEIKVTEQGEVISDKYAIPALARENLELTLAATLEATVL
FT                   HRAPRQSAEDLATWSATMEGVSSAGQDRYRELVEHPDLPAYFFASTPVDLLGDLHLGSR
FT                   PSRRPDTSAGIDGLRAIPWVFGWTQSRQIVPGWFGVGTGLAAARQNPAFAGTDWQDMYE
FT                   RWHFFRNFLGNVSMTLAKTDLRIARHYVETLVPRELHHFFDTITEEYERTVAEVLRITG
FT                   ESELLGRNETLARTLRVRDMYLDPISYMQVSLLKRQREATKAGLPVDPDLARALLLSVN
FT                   GIAAGLKNTG"
     gtgtccgccg taccgtcgcc caagaacgac gacgccgccg tagagacccc gacagacagc        60
     ccgaccgctc gcgcgaacga caccgcgaac gacaaccccc cgcgcaccgc cgacgacgcc       120
     gagctgcgcg ccgcgatccg ccggttgggg gacctgctgg gccagaccct ggtccgccag       180
     cacggtccgg agctgctgga gcaggtcgag gccatccgcg cgctgggcaa gcagggcgcc       240
     gacgtgtccg agctgctcgc cgcggtggac cccgagcagg ccatcaagct ggtccgcgcg       300
     ttcaccgcct acttcaacct cgccaacacc gccgagcagg tccaccgcgg ccgggagctg       360
     gccgccaccc gggccgccga gggctcctgg ctgggccagg cggtggaccg gatccaggcc       420
     gcgggcctgg ccggcacggc cgccgaggcg gtgtcgcacc tgtcggtccg cccggtcttc       480
     accgcgcacc cgaccgaggc cgcgcgccgc accgtgctcg ccaagctgcg caaggtcgcc       540
     gagctgctcg aggcgccgca gaccgcttac aacgagcgcc gtctggccga gaccgtcgag       600
     cagctgtggc agaccgacga gatccgcatc acccggcccg agccggtgga cgaggcgcgc       660
     aacgccgtct actacctcga cgagctcgcc gcgcacgccg cgccggaggt cctggaggag       720
     ctggcggtgg agctgcggcg cctgggcgtc gagctgccgc tgtcggcccg gccgctgagc       780
     ttcggctcct ggatcggcgg cgaccgcgac ggcaacccga acgtcacgcc gcagatgacc       840
     ctggacgtgc tggagctcca gcacgagcac gccatccgca ccgcgctggc gtccatggac       900
     gccctgcgcg agatcctgtc cacctccgag cggatcgccg ccccgaccga ggcgctgcgg       960
     gcctcgctgg acgccgacct cgaggcgctg ccggagatcc cgaaccgcta ccggcggctc      1020
     aacgccgagg agccataccg cctcaaggcg acgacgatcc ggcagaagct cctcaacacc      1080
     cgcacccgca tcgccgaggg ccgccagcac gacccgcgcc gggactacct cggcacctcc      1140
     gagctgctgc gcgacctgag cctgatgcgc gactcgctct acgccgaccg cggcgagctg      1200
     atcgccaccg gcgagctgga gaccgcgatc cgcaccatcg ccgccttcgg gctgcaccac      1260
     gcggtcctgg acgtgcgcga gcacgccgac gcccaccacc acgtgctggc gcagctcttc      1320
     gaccggctcg gcgaccagcc ctggcgctac tccgacctcc cgcgcgacta ccggacccgg      1380
     ctgctggcca aggagctggc ctcctcccgt ccgctgtccg cgctcggaca ggtcccggcc      1440
     gacaccctgc tggacgccgc cggcgtcaag agcttcgggg tgttcaccgc gatccgcacc      1500
     gcgttcgaga agtacggccc ggacgtcatc gagtcctaca tcgtctcgat gacccgcggc      1560
     gtggacgacc tgttcgccgc ggtcgtgctg gcgcgcgagg ccggtctggt ggacgtgcac      1620
     gcgcacaccg cggccatcgg cttcgtcccg ctgctggaga ccccggacga gctgaagatc      1680
     gccgggtcga tcctggacga gatgctgtcc gacccctcct acgcggcgat cgtcgcggcg      1740
     cgcggcggcg tgcaggaggt catgctcggc tacagcgact ccaacaagat gggcgggatc      1800
     tccacctcgc agtgggagat ccaccgcgcg cagcgcgaac tgcgcgacac cgcgctgcgc      1860
     cacggcatcc gcatccggct gttccacggc cgcggcggca gcgtcggacg cggcggcggt      1920
     ccgtcgcacg acgcgatcct cgctcagccc tggggcacgc tcgacggcga gatcaaggtg      1980
     accgagcagg gcgaggtcat ctccgacaag tacgcgatcc cggcgctggc gcgggagaac      2040
     ctggagctga cgctcgccgc gacgctggag gccacggtgc tgcaccgcgc gccgcgccag      2100
     tccgcggagg acctggcgac ctggtcggcg accatggagg gggtctcctc ggcgggccag      2160
     gaccgttacc gggagctggt cgagcacccg gacctgccgg cgtacttctt cgcctcgacc      2220
     ccggtggacc tgctcggcga cctgcacctg gggtcccggc cctcgcgccg tccggacacc      2280
     tcggccggca tcgacggcct gcgcgcgatc ccgtgggtct tcggctggac gcagtcgcgg      2340
     cagatcgtgc ccggctggtt cggcgtcggc accggcctgg ccgccgcccg gcagaacccc      2400
     gcgttcgccg gcacggactg gcaggacatg tacgagcgct ggcacttctt ccgcaacttc      2460
     ctgggcaacg tctcgatgac gctggccaag accgacctgc ggatcgcccg gcactacgtg      2520
     gagaccctgg tcccgcgcga gctgcaccac ttcttcgaca ccatcaccga ggagtacgag      2580
     cgcacggtcg ccgaggtgct gcgcatcacc ggcgagtccg aactcctcgg ccgcaacgag      2640
     acgctggccc gcaccctgcg cgtccgcgac atgtacctgg acccgatctc gtacatgcag      2700
     gtctcgctgc tcaagcgcca gcgcgaggcg acgaaggcgg gtctgccggt ggacccggac      2760
     ctggcccgcg cgctgctgct gtcggtgaac ggcatcgccg ccgggttgaa gaacaccggc      2820
     tga                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page