(data stored in ACNUC7421 zone)

EMBL: CP001700.PE179

CP001700.PE179       Location/Qualifiers
FT   CDS_pept        192506..193534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0179"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: sgr:SGR_6861 putative signal
FT                   peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69134"
FT                   /db_xref="GOA:C7QHJ5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ5"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ACU69134.1"
FT                   /translation="MAATDPGAPVGSQPAEPPFGDGYGTTGNGYGQQHGFGTENGYGTE
FT                   NGYGAENGYGSAPGFASENGYSQDQGYASEHAFGTQNGYDPVAGDGSAATDPATDPDAA
FT                   DEELAAVPSRGGGRRAARTKAKRRRIPAWLEIVGYVVISLTLTSLIKTFLVQMYYIPSP
FT                   SMEPTTYKGDRVFVDKLSSWVGGAPARGQVIVFHDPHNWLMSSAGSTGGAINLPDVLAA
FT                   VGILPDQHDDLLIKRIIGTGGDTIECKTQDGPVYRNGVALDESSYIMNGKQGMPCYNGV
FT                   YKVTVPQGDLWVLGDNREHSGDSSWNYLKKGGDAGFVPTKNVVGHVVGVVSWLRDDHPA
FT                   GS"
     gtggccgcta ctgatcccgg cgcgcccgtg ggctcccagc ccgcggaacc gcctttcggc        60
     gacggctacg ggacgaccgg gaacggttac ggacagcagc acggtttcgg taccgagaac       120
     ggctatggca ccgagaacgg ctacggcgcc gagaacggct acggctccgc gcccggattc       180
     gcctccgaga acggctacag ccaggaccag ggctacgcct ccgagcacgc tttcggtacc       240
     cagaacggct acgacccggt cgccggcgac ggttccgccg ccactgaccc cgccaccgac       300
     ccggacgccg ccgacgagga gctcgcagcc gtcccgagcc gcggcggcgg ccgccgcgcg       360
     gcacgcacca aggcgaagcg gcgccgcatc ccggcgtggc tggagatcgt cggctacgtg       420
     gtcatctcgc tcacgctgac ctcgctgatc aagaccttcc tggtccagat gtattacatc       480
     ccctcgccgt cgatggagcc cacgacgtac aagggcgacc gggtcttcgt cgacaagctg       540
     tccagctggg tcggcggcgc gccggcgcgc gggcaggtca tcgtcttcca cgacccgcac       600
     aactggctga tgagctcggc cggcagcacc ggcggcgcga tcaacctgcc ggacgtcctg       660
     gccgccgtcg gcatcctgcc cgaccagcac gacgacctgc tcatcaagcg gatcatcggt       720
     accggcgggg acaccatcga gtgcaagacg caggacggac cggtgtaccg caacggcgtg       780
     gcgctggacg agtcctcgta catcatgaac ggcaagcagg ggatgccctg ctacaacggc       840
     gtctacaagg tgacggtccc gcagggcgac ctgtgggtgc tcggcgacaa ccgcgagcac       900
     tccggcgact cctcgtggaa ctacctgaag aagggcggcg acgcgggctt cgtgccgacc       960
     aagaacgtgg tcggacacgt ggtcggtgtc gtgtcctggc ttcgcgacga tcatcccgcg      1020
     ggttcgtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page