(data stored in ACNUC7421 zone)

EMBL: CP001700.PE18

CP001700.PE18        Location/Qualifiers
FT   CDS_pept        complement(19886..20500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68973"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68973.1"
FT                   /translation="MRIRPVLAVAGSVFLFSSNGFAAHAATQAPSGNSLPATGTAVSLT
FT                   EDGDMVLECNGVLHRFEVLGTGQVRVGARVAGDQPTVAVRTEAEQLTGYDADLGTVTVS
FT                   EKTPADGDFVAPAVGREFPAAESLAQDLTISMQHSPCGGGEPATFTNKAAFPLLNTNMT
FT                   AFPPRNAVFLMTDPVELTDIANPSGPSIMLTEFPLTITQAA"
     atgagaattc gtcccgtgct ggccgtcgcc ggctcagtct ttctgttctc ctccaacggc        60
     ttcgccgccc acgccgcgac ccaggcacct agcgggaact ccttacccgc caccggaacc       120
     gccgtctctc tcaccgaaga cggcgacatg gtgttggagt gcaacggcgt cctgcaccgc       180
     ttcgaggtgc tgggcaccgg acaggtacgg gtcggcgccc gagtggccgg ggatcagccg       240
     accgtcgccg tacggaccga agccgagcag ctgacggggt acgacgccga cctcggcacg       300
     gtgacggtgt cggagaagac cccggccgac ggcgacttcg tcgccccggc ggtcggccgg       360
     gagttcccag cggccgagtc gctggcccag gatttgacca tctccatgca gcacagtccg       420
     tgcggcggcg gcgagcccgc gacgttcacg aacaaggccg cgttcccttt gctgaacacg       480
     aatatgacgg ctttcccgcc gcggaacgcg gtcttcctga tgaccgatcc cgtggagctg       540
     acggacatcg cgaacccgtc agggccctcc atcatgctga cggagttccc gctgacgatc       600
     acgcaggcgg catga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page