(data stored in ACNUC7421 zone)

EMBL: CP001700.PE180

CP001700.PE180       Location/Qualifiers
FT   CDS_pept        193634..195694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0180"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: sma:SAV_1715 non-hemolytic phospholipase C;
FT                   TIGRFAM: phospholipase C, phosphocholine-specific; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69135"
FT                   /db_xref="GOA:C7QHJ6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ6"
FT                   /inference="protein motif:TFAM:TIGR03396"
FT                   /protein_id="ACU69135.1"
FT                   /translation="MTAVNRRRFLQITGGTAAATSMPMLTASIARAAAVRPARRTGTIK
FT                   DIEHVVILMQENRSFDHYFGTLRGVRGFGDPRPARLPNGKAVWHQADAAGNEILPWRPT
FT                   GVPDLGLKFLDGLDHSWNGGHHAWNQGNYDQWVPAKGPGTMAHFERQDIPFHFALADAF
FT                   TVCDAYHCSLMTSTDPNRYYLWTGFTGNDGKAGGPVLDNAEAGYDWTTYPERLQAAGVS
FT                   WKIYQDIGTGLDAKGSWGWTDDAYIGNYGDTSVLYFHQYQNAKPGDPLYDNARTGTNAA
FT                   AGQGYFDLLAQDVKNGKLPQVSWITAPEAFSEHPNWPVNYGAWYVSQVLDILSSDEDLW
FT                   SKTALFIMYDENDGFFDHVVPPFVPGGAVGGASTVDTSTEYYSAGAGFDAGSYGLGLRV
FT                   PMFVVSPWSKGGWVDSETFDHTSVIRFLEKRFGVHEPNISPWRRAVCGDLTSAFDFGLR
FT                   ETEVPALPSTASYVPPDHARHSSYPVTLPASASLPKQEAGRRPARALPYDLAADGRIAG
FT                   GALRIGFASRGSAGASFVVTSILDKTGPWSYTVGAGHTLDGSWKLSGAYDYDVRGANGF
FT                   LREFKGDAAKAGLEVVAEHVGNSQNLKLTLTNTGSADVTATVVDSYGCDGKAVLRVRAG
FT                   KHATHVVPAGASDGWYDATVTSDHDAAYVRRFAGHTENGRPSVSDPAIITG"
     atgaccgcag tgaatcgtcg ccggttcctc cagatcaccg gcggcaccgc cgccgcgacc        60
     tcgatgccca tgctcaccgc gagcatcgcc cgcgccgccg cggtgcggcc cgcccgccgg       120
     acgggaacca tcaaagacat cgagcacgtg gtgatcctga tgcaggagaa ccgcagcttc       180
     gaccactact tcgggacgct gcgcggggtg cgcggcttcg gcgacccgcg gccggcacgg       240
     ctgccgaacg gcaaggcggt ctggcaccag gccgacgccg ccggaaacga gatcctgccc       300
     tggcgcccga ccggcgtccc ggatttgggc ctgaagttcc tggacggtct ggaccacagc       360
     tggaacggcg gccaccacgc ctggaaccag gggaactacg accagtgggt cccggccaag       420
     ggcccgggga cgatggctca cttcgagcgc caggacatcc cgttccactt cgcgctggcc       480
     gacgccttca cagtctgcga cgcctatcac tgctcgctga tgacctcgac cgacccgaac       540
     cgctactacc tgtggaccgg cttcacgggc aacgacggca aggccggcgg accggtcctg       600
     gacaacgccg aggccggcta cgactggacc acctaccccg agcggctgca ggccgccggc       660
     gtctcctgga agatctacca ggacatcggc accggtctgg acgcgaaggg ctcctggggc       720
     tggaccgacg acgcctacat cggcaactac ggcgacacct cggtgctgta cttccaccag       780
     tatcagaacg cgaagcccgg cgacccgctc tacgacaacg cgcgcaccgg caccaacgcc       840
     gcggccgggc agggctactt cgacctgctg gcgcaggacg tgaagaacgg caagctgccg       900
     caggtctcct ggatcaccgc gccggaggcg ttcagcgagc acccgaactg gccggtgaac       960
     tacggcgcct ggtacgtctc gcaggtcctg gacatcctgt cctcggacga ggacctgtgg      1020
     agcaagaccg cgctgttcat catgtacgac gagaacgacg gcttcttcga ccacgtggtc      1080
     ccgccgttcg tgccgggcgg cgcggtcggc ggcgcctcca cggtcgacac ctccaccgag      1140
     tactactccg ccggcgccgg cttcgatgcc gggtcctacg gcctgggcct gcgcgtgccg      1200
     atgttcgtgg tctcgccctg gagcaagggc ggctgggtgg actccgagac cttcgaccac      1260
     acctcggtga tccgcttcct ggagaagcgt ttcggcgtgc acgagcccaa catctcgccg      1320
     tggcgccgtg ccgtctgcgg cgacctgacc agcgccttcg acttcggtct gcgcgagacc      1380
     gaggtcccgg cgctgccgag caccgcctcc tacgtcccgc cggaccacgc acgccactcc      1440
     agctaccccg tgaccctgcc ggcgagcgcg tcgttgccga agcaggaggc cggccggcgc      1500
     cccgcccgcg cgttgccgta cgacctggcg gcggacggcc ggatcgcggg cggggcgctg      1560
     cggatcggct tcgccagccg tggcagcgcg ggcgcgagct tcgtggtgac ctcgatcctg      1620
     gacaagaccg gaccgtggag ctacacggtc ggcgcgggcc acaccctcga cggctcgtgg      1680
     aagctgtcgg gcgcgtatga ctacgacgtg cgcggtgcca acggcttcct gcgcgagttc      1740
     aagggcgacg ccgccaaggc cgggctcgaa gtcgtcgccg agcacgtcgg gaacagccag      1800
     aacctgaagc tgacgctgac caacaccggc tccgccgacg tcaccgcgac cgtcgtcgac      1860
     tcctacggct gcgacggcaa ggcggtcctg cgggtgcggg ccggcaagca cgcgacgcac      1920
     gtcgtgccgg cgggcgcctc cgacggttgg tacgacgcca cggtcacctc cgaccacgac      1980
     gccgcgtacg tgcggcgctt cgccggccac accgagaacg gccggccgag cgtgagcgac      2040
     ccggcgatca tcacgggctg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page