(data stored in ACNUC7421 zone)

EMBL: CP001700.PE182

CP001700.PE182       Location/Qualifiers
FT   CDS_pept        196190..196912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GJ22283 gene product from transcript GJ22283-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69137"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69137.1"
FT                   /translation="MTLRTRLSAAAVGALIAVGAVALPAQAATASDPAAGLAKAKAAVT
FT                   EGITDRLTTLGHLQTALTGYKEVTDAARGTLTQVLSSDVSGLTALKTKVAAETTEAAVR
FT                   TDGKTMVDDYRVYVLVAPKVHLTHALDVEGAALAKLVKVHDALADRLAKDPTANTAANK
FT                   ALLADMTSQIQSATTAIAGKDAALLALQPTPDGKALTASVKAISAPAKDARDDIKKAVD
FT                   DAKKVRDALKGTKTTTKS"
     atgactctgc gcacccgttt gagcgccgcc gctgtcggcg ccctcatcgc cgtcggcgcg        60
     gtcgccctgc ccgcgcaggc cgccaccgcc tccgaccccg ccgccgggct ggccaaggcc       120
     aaggccgcgg tcaccgaggg catcaccgac cggctgacca cgctgggcca tctgcagacc       180
     gcgctgaccg gctacaaaga ggtgaccgac gccgcgcgcg gcacgctcac ccaggtgctc       240
     tcctccgacg tcagcggtct gaccgcgctg aagacgaagg tcgccgcgga gacgaccgag       300
     gccgcggtcc gcaccgacgg caagacgatg gtcgacgact accgcgtcta cgtcctggtc       360
     gcgccgaagg tccacctcac ccacgcgctg gacgtcgagg gcgccgcact ggcgaagctg       420
     gtgaaggtcc acgacgccct ggccgaccgc ctcgccaagg acccaaccgc gaacaccgcc       480
     gcgaacaagg ccctcctggc agacatgacc tcgcagatcc agtccgccac caccgcgatc       540
     gccggcaagg acgccgccct cctggcactc cagcccactc cggacggcaa ggccctgacc       600
     gcgtcggtga aggcgatcag cgccccggcg aaggacgccc gcgacgacat caagaaggcc       660
     gtcgacgacg ccaagaaggt gcgcgacgcc ctgaagggca ccaagaccac cacgaagagc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page