(data stored in ACNUC7421 zone)

EMBL: CP001700.PE183

CP001700.PE183       Location/Qualifiers
FT   CDS_pept        complement(197393..197938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_2083 putative outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69138"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69138.1"
FT                   /translation="MAFLKNATVIAALASAGVVGMAGIASAAADDAWNGGAEHHKTGDN
FT                   NVGQGGLIPVNALNNVNVSPNLGCLAHNTVPDLNVQSLVGLVPIGVGLNHLLEHTHLNV
FT                   LSNGNIDTDVNDNSCTSNQGSSQAGNNSRGSVGAGDSSSSHSTGDGAGSQNNGAGAGAG
FT                   GLIGSSGLLGKGGLNLGG"
     atggcatttc tgaagaacgc caccgttatc gccgcgctgg ccagcgcggg tgtcgtgggc        60
     atggccggca tcgcctccgc ggcggccgac gacgcctgga acggcggcgc cgagcaccac       120
     aagaccggcg acaacaacgt cggccagggc ggcctcatcc cggtcaacgc gctgaacaac       180
     gtcaacgtct ccccgaacct gggctgcctg gcgcacaaca ccgtgccgga cctgaacgtc       240
     cagagcctgg tcggcctggt gccgatcggc gtcggcctga accacctgct ggagcacacc       300
     cacctgaacg tgctcagcaa cggcaacatc gacaccgacg tcaacgacaa ctcctgcacc       360
     tcgaaccagg gttcgtcgca ggccggcaac aacagccgcg gcagcgtggg cgcgggcgac       420
     agcagcagct cgcactccac cggcgacggc gcgggctcgc agaacaacgg cgccggtgcc       480
     ggcgccggcg gcctgatcgg gtcctcgggc ctgctgggca agggcggcct gaacctcggc       540
     ggctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page