(data stored in ACNUC7421 zone)

EMBL: CP001700.PE184

CP001700.PE184       Location/Qualifiers
FT   CDS_pept        complement(198345..198791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69139"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69139.1"
FT                   /translation="MRTRAIFTAAAATAATLGGVLASAGTAAATTTKTTTPSRPTAPQA
FT                   SPTPGVLAVENALELADDWCVAPLHFAGPLAADPLPTASHACGHGRAGGGVRVLSDLCI
FT                   APITTDDPSGSWAAPSTPCKNAGSAGSGFGILRDVSVAGVQATF"
     ttgcgtaccc gggcgatctt cacggcggcg gccgcgaccg ctgccacgct cggtggcgtt        60
     ctggcctcgg ccggcaccgc cgcggcgacg accaccaaga cgacgactcc ttcgcgcccg       120
     acagcgcccc aggcaagccc gacgccgggc gtcctggctg tcgagaacgc gttggaactc       180
     gccgacgact ggtgtgtcgc cccgctgcac ttcgccggac cgctggccgc ggatccctta       240
     ccgaccgcct cccacgcctg cggccacggc cgcgccggcg gaggggtgcg cgttctgagc       300
     gacctgtgta tcgcgccgat caccacggac gacccttcgg gatcctgggc ggcgccctcc       360
     acaccgtgta agaacgcggg ctccgcggga agcggtttcg ggatccttcg cgacgtgtcc       420
     gtggcgggcg ttcaggccac cttctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page