(data stored in ACNUC7421 zone)

EMBL: CP001700.PE185

CP001700.PE185       Location/Qualifiers
FT   CDS_pept        complement(198853..199518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmo:HM1_1325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69140"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69140.1"
FT                   /translation="MRKYLSLAVVALSSGGALFAAAGAASAATSTDSLRAAPWQATSPL
FT                   AMHAAPFGDHDVMGLCGMQRDNVRTGQIDADLVQKLCAGEGDMMTPPVPGPPPVMTPPP
FT                   PPMGSPSPCTEVCKPVHHHHPKPPTPPTHPTPPPPPPVTQPCPPPPCPPVTPPPPPPCP
FT                   PVMPPPPVPCPPPTPNPCPPGHEHGWSAEPDAATQAAPAAGNAVAGLPILGSVAGGLL"
     atgcgcaaat atctgtccct cgccgtagtg gctttgtctt ccggcggggc gctgttcgca        60
     gccgccggcg ccgccagcgc ggccacgagc accgacagcc tgcgtgcggc gccctggcag       120
     gcgaccagcc cgctggcgat gcacgcggcg ccgttcggcg accacgacgt catgggtctg       180
     tgcggcatgc agcgcgacaa cgtgcgcacc ggtcagatcg acgccgacct ggtgcagaag       240
     ctgtgcgccg gcgagggcga catgatgacg cccccggttc ccggcccgcc gccggtcatg       300
     accccgccgc cgccgccgat gggctcgccg tcgccgtgca ccgaggtctg caagccggtc       360
     caccaccacc acccgaagcc gccgacgccg ccgacccacc cgacgccgcc gcccccgccg       420
     ccggtgacgc agccgtgtcc gccgccgccg tgcccgccgg tcacgcctcc gccgccgccc       480
     ccgtgcccgc cggtcatgcc cccgccgccg gtgccgtgcc cgcccccgac cccgaacccg       540
     tgccccccgg gccacgagca cggctggtcg gctgagccgg acgccgccac ccaggcggcc       600
     ccggcggccg gcaacgccgt cgccggcctg ccgatcctcg gcagcgtcgc gggcggcctg       660
     ctctag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page