(data stored in ACNUC7421 zone)

EMBL: CP001700.PE186

CP001700.PE186       Location/Qualifiers
FT   CDS_pept        complement(199793..200272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0186"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sma:SAV_788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69141"
FT                   /db_xref="GOA:C7QIZ9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ9"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACU69141.1"
FT                   /translation="MEARLNTFATPTGAKFGKYLIAAGRVLREAGVPVATLHLVEIRAS
FT                   QINGCGFCLDMHTKDATAAGETAERLNMVAAWREAACYTEAERAALELTEAGTRLADGT
FT                   GVADEVWDAAAKHFDEDQLATLVAQIALINAFNRGNVMVKQPAGDYVPGQFDDAE"
     atggaagccc gtctgaacac cttcgccacc ccgaccggcg ccaagttcgg caagtacctg        60
     atcgccgcgg gccgcgtcct gcgcgaggcc ggcgtcccgg tcgcgaccct gcacctggtc       120
     gagatccgcg ccagccagat caacggctgc ggcttctgcc tggacatgca caccaaggac       180
     gccacggccg ccggcgaaac agcggagcgg ctgaacatgg tcgccgcctg gcgcgaggcc       240
     gcctgctaca ccgaagccga gcgcgccgcg ctggagctga ccgaggccgg cacccggctg       300
     gccgacggca ccggcgtcgc cgacgaggtg tgggacgccg ccgccaagca cttcgacgag       360
     gaccagctcg ccacgctggt ggcgcagatc gcgctgatca acgccttcaa ccgcggcaac       420
     gtcatggtca agcagccggc cggggactac gtgcccggcc agttcgacga cgccgagtaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page