(data stored in ACNUC7421 zone)

EMBL: CP001700.PE187

CP001700.PE187       Location/Qualifiers
FT   CDS_pept        complement(200393..201403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69142"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ00"
FT                   /inference="similar to AA sequence:KEGG:SAV_3557"
FT                   /protein_id="ACU69142.1"
FT                   /translation="MAQASAQRHGIPNGQFAGRIIEFSDPELDRKFPHGIYLTMHGYPE
FT                   FAVYARHTVQIADPPSGLSVDEIRVTDVIAANLLAADAGDPLWQTRPNTATPQGWTWAH
FT                   AAESRMLHCVPIELHGAFRHHGGMATLKADRGRSGLFTEGMLEPVAFERSGSVPEDAMA
FT                   QLEQHLGFALPPSYRRFLAGTDGGRPISPAVNLAGGFVADQWMFGLRREDPHQDLVYAN
FT                   QALYDRFTEEYLGIGYVQGGMLALKIRGAEAGSVWLFDDDDPRDSESRDAGSVCAELLK
FT                   KIGSDFDDFARHLVALPQQIVDIARSAVDSGHAKSITDIEHLGAALPEGLKAPRR"
     atggcacagg catccgcaca gcggcacggc ataccgaacg gccagttcgc cggacggatc        60
     atcgagttca gcgaccccga actcgaccgc aagttcccgc acggcatcta cctgaccatg       120
     cacggctacc cggagttcgc cgtctacgcc cgccacacgg tgcagatcgc ggacccgccc       180
     tccggcctgt ccgtggacga gatccgggtc accgacgtca tcgccgccaa cctgctggcc       240
     gccgacgccg gggacccgct gtggcagacc cggccgaaca ccgccacgcc gcagggctgg       300
     acctgggcac acgccgcgga gtcgcgcatg ctgcactgcg tgccgatcga gctgcacggc       360
     gccttccggc accacggcgg catggccacg ctgaaggccg accgcggccg ctcggggctg       420
     ttcaccgagg gcatgctgga gccggtcgcc ttcgagcgca gcggctcggt gcccgaggac       480
     gcgatggcgc agctggagca gcacctgggc ttcgcgctgc cgccgtccta ccggcgcttc       540
     ctggccggca ccgacggcgg ccggccgatc agcccggcgg tgaacctggc cggcggcttc       600
     gtcgccgacc agtggatgtt cgggctgcgc cgcgaggacc cgcaccagga cctggtctac       660
     gccaaccagg cgctgtacga ccggttcacc gaggagtacc tcggcatcgg ctacgtccag       720
     ggcggcatgc tggcgctgaa gatccgcggc gccgaggccg gctcggtctg gctgttcgac       780
     gacgacgacc cgcgcgattc ggagagccgc gacgccggca gcgtgtgcgc cgagctgctg       840
     aagaagatcg gcagcgactt cgacgacttc gcccggcacc tggtcgcgct gccgcagcag       900
     atcgtggaca tcgcgcgctc cgcggtggac tccgggcacg ccaagtcgat caccgacatc       960
     gagcacctcg gtgcggcgct gccggaaggg ctgaaggcgc cgcggcgctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page