(data stored in ACNUC7421 zone)

EMBL: CP001700.PE188

CP001700.PE188       Location/Qualifiers
FT   CDS_pept        201624..205172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0188"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: sma:SAV_3549 transcriptional-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69143"
FT                   /db_xref="GOA:C7QJ01"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ01"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACU69143.1"
FT                   /translation="MSLSGLLDAVSADPGVAALLEAAATAGRTSFDLAAPRSVRPFALA
FT                   ALARAQGPAGRPVLAVTATGREAEDLVAALRGLLDPETVVDFPSWETLPHERLSPRSDT
FT                   VGRRLAVLRRLVHPDAATEGAGALKVVVAPIRSVLQPQVKGLADLVPVAARTGAEIDLD
FT                   DLVNRLAAAAYTRTDLVDKRGEFAVRGGIVDVFPPTEEHPLRLEFWGDQIEEIRYFKVA
FT                   DQRSLEVAEHGLWAPPCRELLLTDEVRKRAAALMEDHPELADILGKVSEGIGVEGMESL
FT                   APVLVDDMELLIDLLPAGSPIVLCDPERVRTRAADLAATSAEFLDASWAATAGGGQTPI
FT                   DLGAASLKDLASVREHAITLGLPWWSLTPFAPDLELLPEEDATEISEIHDTEQYGGDTG
FT                   RALADVRARISEGWRVVLVTQGHGSADRLVEVLKGADIGARYVPELDTVPEPALATVAT
FT                   ASIEHGFIAADLKLWVITEQDVSGQRTATKDMSRMPSRRRNVIDPLQLKAGDPVVHEQH
FT                   GVGRYVEMAQRTVAGATREYLVIEYAAAKRGQPGDRLFVPTDQLDQVTKYVGGEAPSLH
FT                   RLGGADWQKAKSRARKAVKQIAGDLVKLYSARMAAPGHAFAADTPWQRELEDAFPYVET
FT                   PDQLACIDEVKSDMEKPVPMDRLICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPTTLL
FT                   VQQHFSTFAERYAQFPVTLKGLSRFQTDKEAAEVLRGVADGSVDVVIGTHRLLANSVKF
FT                   KRLGLVIVDEEQRFGVEHKEQLKQARANVDVLTMSATPIPRTLEMAVTGIREMSTIQTP
FT                   PEERHPVLTFVGPYEERQISAAIRRELLREGQAFYIHNRVESIDRAASRLRALVPEARI
FT                   ATAHGQMNEHVLEKLIVDFWNKEYDVLVCTTIVESGIDITNANTLIVERADNFGLSQLH
FT                   QLRGRVGRGRERAYSYFTYPPEKPLTETAHERLATIAQHTDLGAGMYVAMKDLEIRGAG
FT                   NLLGGEQSGHIEGVGFDLYIRMVGEAVEEYRAQAEGREVEEQVEIRVDLPVDAHLPHDY
FT                   IPGERLRLEAYKRIAGATTHEELAEVRQEFTDRYGRFPQPVENLLAVAAFRIDARAAGL
FT                   TEVAVQGNFVKFGPVKLRESQEMRLLRLFPKTLVKAATDTMLVPKPMTARIGGQPLRDQ
FT                   ELLGWARDLIDAVLKM"
     gtgagcctgt ccggacttct tgacgccgta tccgccgacc cgggggtcgc cgcgctgctg        60
     gaagcggccg cgaccgccgg gcgtacctcc ttcgacctgg ccgcgccccg ctcggtccgg       120
     ccgttcgcgc tggccgcgct ggcccgcgcg caaggcccgg cgggccgtcc ggtgctggcc       180
     gtgaccgcca ccggccgcga ggccgaggac ctggtcgccg cgctgcgcgg gctgctggac       240
     cccgagacgg tcgtggactt cccgtcctgg gagacgctgc cgcacgagcg gctctcgccg       300
     cgcagcgaca ccgtcgggcg ccggctggcc gtgctgcgcc gcctggtcca ccccgacgcc       360
     gccaccgagg gcgccggcgc cctgaaggtg gtcgtggcgc cgatccgctc ggtgctgcag       420
     ccacaggtca agggcctggc cgacctggtc ccggtggcgg cgcgcaccgg cgcggagatc       480
     gatctggacg acctggtgaa ccggctcgcc gccgccgcgt acacccggac ggacctggtg       540
     gacaagcgcg gcgagttcgc ggtccgcggc ggcatcgtcg acgtcttccc gccgaccgag       600
     gagcacccgc tgcggctgga gttctggggc gaccagatcg aggagatccg ctacttcaag       660
     gtcgccgacc agcgctcgct ggaggtcgcc gagcacgggc tgtgggcgcc gccgtgccgc       720
     gagctgctgc tcaccgacga ggtccgcaag cgggccgcgg cgctgatgga ggaccacccg       780
     gagctggccg acatcctcgg gaaggtctcc gagggcatcg gcgtggaggg gatggagtcg       840
     ctggcgccgg tgctggtcga cgacatggag ctcttgatcg acctgctgcc ggccggctcg       900
     ccgatcgtgc tctgcgaccc cgagcgggtg cggacccgcg ccgccgacct ggccgccacc       960
     tccgcggagt tcctggacgc ctcctgggcc gccaccgccg gcggcgggca gaccccgatc      1020
     gacctcggcg cggcctcgct gaaggacctc gcctcggtcc gcgagcacgc catcaccctg      1080
     ggcctgccct ggtggtcgct gacgcccttc gccccggacc tggagctgct gccggaggag      1140
     gacgccaccg agatcagcga gatccacgac accgagcagt acggcggcga caccggccgc      1200
     gcgctcgccg acgtccgggc ccgcatctcc gagggctggc gggtggtgct ggtcacccaa      1260
     ggccacggct cggccgaccg cctcgtcgag gtgttgaagg gcgctgacat cggcgcgcgc      1320
     tacgtcccgg agctggacac cgtcccggaa ccggcgctgg cgaccgtggc caccgccagc      1380
     atcgagcacg gcttcatcgc cgcggacctc aagctctggg tgatcaccga gcaggacgtc      1440
     tccgggcagc gcacggcgac caaggacatg tcccgcatgc cctcccggcg ccgcaacgtc      1500
     atcgacccgc tgcagctcaa ggccggggac ccggtcgtgc acgagcagca cggcgtgggc      1560
     cgctacgtgg agatggcgca gcgcaccgtc gccggcgcga cccgcgagta cctggtgatc      1620
     gagtacgccg cggccaagcg cggccagccc ggcgaccggc tgttcgtccc caccgaccag      1680
     ctggaccagg tcaccaagta cgtcggcggc gaggcgccct cgctgcaccg gctcggcggc      1740
     gcggactggc agaaggcgaa gtcccgggcc cgcaaggcgg tcaagcagat cgccggggac      1800
     ctggtgaagc tgtacagcgc gcggatggcc gcgccggggc acgccttcgc cgcggacacg      1860
     ccgtggcagc gcgagctgga ggacgccttc ccctacgtgg agacgccgga ccagctggcg      1920
     tgcatcgacg aggtgaagtc cgacatggag aagccggtcc cgatggaccg gctgatctgc      1980
     ggcgacgtcg gctacggcaa gaccgagatc gcggtgcgcg cggcgttcaa ggcggtgcag      2040
     gacggcaagc aggtggcggt gctggtgccg accacgctgc tggtgcagca gcacttctcg      2100
     acgttcgccg agcggtacgc gcagttcccg gtgaccctca agggcctgtc ccggttccag      2160
     accgacaagg aggccgccga ggtgctgcgc ggcgtggccg acggctcggt cgacgtcgtc      2220
     atcggcacgc accggctgct ggcgaactcg gtgaagttca agcgcctcgg cctggtgatc      2280
     gtcgacgagg agcagcgctt cggcgtcgag cacaaggagc agctgaagca ggcgcgggcc      2340
     aacgtggacg tgctgaccat gtccgccacg ccgatcccgc gcaccctgga gatggcggtc      2400
     accggcatcc gggagatgtc cacgatccag accccgccgg aggagcggca cccggtgctg      2460
     accttcgtcg ggccgtacga ggagcggcag atctccgccg cgatccgccg cgagctgctg      2520
     cgcgaggggc aagcgttcta catccacaac cgggtggagt ccatcgaccg cgcggcctcg      2580
     cggctgcgcg cgctggtgcc cgaggcgcgg atcgcgaccg cgcacggcca gatgaacgag      2640
     catgtgctgg agaagctgat cgtcgacttc tggaacaagg agtacgacgt cctggtctgc      2700
     accacgatcg tggagtccgg catcgacatc accaatgcca acaccctgat cgtcgagcgc      2760
     gccgacaact tcggcctgtc ccagctgcac cagctgcgcg gccgggtcgg gcgcgggcgc      2820
     gagcgcgcgt actcctactt cacctacccg ccggagaagc cgctgaccga gaccgcgcac      2880
     gagcgcctgg cgaccatcgc gcagcacacc gacctcggcg ccggcatgta cgtggcgatg      2940
     aaggacctgg agatccgcgg cgccggcaac ctcctgggcg gcgagcagtc cgggcacatc      3000
     gagggcgtcg gcttcgacct ctacatccgc atggtcggcg aggcggtcga ggagtaccgc      3060
     gcgcaggccg agggccgcga ggtcgaggag caggtggaga tccgcgtgga cctgccggtc      3120
     gacgcgcacc tgccgcacga ctacatcccg ggcgagcggc tgcggctgga ggcgtacaag      3180
     cgcatcgccg gcgccaccac ccacgaggag ctcgccgagg tccgccagga gttcacggac      3240
     cgctacggac gttttccaca gcctgtggaa aacctcctcg cggtcgcggc gttccgcatc      3300
     gacgcgcgcg cggccgggct caccgaggtc gcggtccagg gcaacttcgt gaagttcggc      3360
     ccggtgaagc tgcgcgagtc ccaggagatg cggctgctgc gcctgttccc gaagaccctg      3420
     gtgaaggcgg ccaccgacac catgctggtc cccaagccga tgaccgcgcg gatcggcggg      3480
     cagccgctgc gcgaccagga actgctgggc tgggcccggg acctgatcga cgcggtgctg      3540
     aagatgtag                                                              3549
//

If you have problems or comments...

PBIL Back to PBIL home page