(data stored in ACNUC7421 zone)

EMBL: CP001700.PE189

CP001700.PE189       Location/Qualifiers
FT   CDS_pept        205284..206531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0189"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4255 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69144"
FT                   /db_xref="GOA:C7QJ02"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ02"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69144.1"
FT                   /translation="MDATDRLPSQVKALIVARAVNQLGGFSLAFLTVLLTRSFGTSLTT
FT                   AGIVSAAFGLATIPSRLAGGRLADHWGRRRTIVAGLVALAVAQLGLAAAPDLITATICA
FT                   VAMGLAFELFEPPSQATIADAVPPARRASAFELLTTAVAAGSLAAGVIADIVGRWSLRW
FT                   LFVVDAGTGLACAAIVALALAPDAVRKPEHGAESDQPATSAISPWRDPALLIATVSGTV
FT                   FALVSMLMLSALPLALGAVGLNPASAGLIMAASTGTLVLARPVLRRRWLAELPHSATFV
FT                   LGYLLMAAGLCGYAVAHTLPALLVPTALYSLGNLLVLGRSFAVVSELAPASASARYLAV
FT                   YGLSWGVATLLAPLVGTWLIGVSGAGLLWGVSAGVCGVMAVAQPWVVRRVRDSQRDLGV
FT                   IHSTKAAVDRYDAVSI"
     gtggacgcga cggatcgact gcccagccag gtcaaagcac tgatcgtggc gcgcgcggtg        60
     aaccagctgg gcggcttctc cctggcattc ctcaccgtgc tgctgacgcg ctccttcggc       120
     acgagcctga cgacggcggg catcgtctcg gcggcattcg gcctcgcgac gatcccgagc       180
     cgactggccg gcggccgcct cgccgaccac tggggacgcc gccgcacgat cgtggccgga       240
     ctggtcgctc tggcggtggc gcaactggga ttggcggcag cgcccgacct gatcaccgcg       300
     acgatctgcg cggtggcgat gggcctcgcc ttcgaactct tcgaaccacc gagccaggca       360
     accatcgccg acgcggtacc cccagcccgc cgcgcctcag ccttcgaact cctcaccaca       420
     gctgttgcag caggaagcct cgcagccggc gtgatcgccg acatcgtggg ccgctggagc       480
     ctgcgctggc tcttcgtggt cgacgccgga accggcctgg cttgcgcggc gatcgtggcg       540
     ctcgcgctgg cgccagatgc ggtgcgcaag cctgagcacg gcgcggagag tgatcaaccc       600
     gccacttcag cgatctcccc gtggcgcgac ccagcccttc tcatcgcgac cgtctcagga       660
     accgtcttcg cgctcgtctc catgctcatg ctgagcgcgc tcccgctcgc gctcggcgcc       720
     gtcgggctga atccggcgag cgcgggactg atcatggccg cctccaccgg gacccttgtg       780
     cttgcgcgtc cggtcctgcg gcgccggtgg ctcgcggagt tgccgcactc cgccaccttc       840
     gttctcggct atctcttgat ggctgcggga ctttgcggct acgccgtcgc gcacacgctg       900
     ccggctctcc tcgtcccgac tgcgctctac agtctcggaa atcttctggt tctggggcgg       960
     tcgttcgcgg tcgtcagtga gctggctccg gcctcggcct cggcgcggta tctcgcggtc      1020
     tacgggctca gctggggggt ggcgacgttg ctcgcgccgc tggtggggac gtggttgatc      1080
     ggggtttcgg gggcggggtt gctgtggggg gtcagtgccg gggtgtgtgg ggtgatggcg      1140
     gttgcgcagc cgtgggttgt gcggcgggtg cgggattctc agcgtgatct tggtgtgatc      1200
     cactccacaa aggcggcggt ggaccgctac gatgcggtgt cgatctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page