(data stored in ACNUC7421 zone)

EMBL: CP001700.PE19

CP001700.PE19        Location/Qualifiers
FT   CDS_pept        complement(20593..21360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0019"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68974"
FT                   /db_xref="GOA:C7QFN5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68974.1"
FT                   /translation="MSYWSRSFPGLAENLAEVRQFIQMVLGDAPGAELVVLAGSELAGN
FT                   AIVHTASGAPGGQFVVHLAAFADRWQVRVDDAGSPTEPRVLVDSMDEHCDWDSESGRGL
FT                   AMVASISRKWGVLGDRAARAVWAEIPCPVPPGGGIESVMSGGMLEALESVARALENENR
FT                   PPYQELDTSSATAPATAAVPSVAIAPARWPGTMPSDPARAERIRRQASHAAFQRALIES
FT                   AYAETLGPRPLPYWPPFPNPLALQGSSPGTRPR"
     atgtcgtatt ggtctcgctc cttccccgga ctggccgaga acctcgccga ggtccgccag        60
     ttcatccaga tggtgctcgg cgacgcgccg ggcgcggagc tggtggtcct ggccgggtcc       120
     gaactggccg gcaacgccat cgtgcacacc gccagcggcg cgcccggcgg ccagttcgtg       180
     gtgcacctcg cggccttcgc ggaccgctgg caggtgcggg tcgacgacgc gggctcgccg       240
     accgagccgc gtgtcctggt cgacagcatg gacgagcact gcgactggga ctcggagtcc       300
     gggcgcgggc tggcgatggt cgcctcgatc tcccggaagt ggggcgtgct cggcgaccgg       360
     gccgcgcggg cggtgtgggc cgagatccct tgtcccgtcc cgcccggcgg cgggatcgag       420
     tcggtgatgt ccggcggcat gctcgaagcc ttggagtccg tggcacgcgc gctggaaaac       480
     gaaaatcggc cgccgtatca ggaacttgat acttcttcag ccaccgcgcc cgcgacggcc       540
     gctgtccctt ctgtggccat cgcgccggcg cggtggcctg gaacgatgcc cagcgatccg       600
     gcgcgggccg aacggatccg gcggcaggcc agccacgccg ccttccagcg cgcgctgatc       660
     gagagcgcgt acgccgaaac gctcgggccg cgtccgctgc cgtactggcc accgttcccg       720
     aatccgcttg ctctgcaagg gtcttcgccc gggacgcgtc ctcgatag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page