(data stored in ACNUC7421 zone)

EMBL: CP001700.PE190

CP001700.PE190       Location/Qualifiers
FT   CDS_pept        206576..207328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0190"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sma:SAV_3538 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69145"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ03"
FT                   /inference="similar to AA sequence:KEGG:SAV_3538"
FT                   /protein_id="ACU69145.1"
FT                   /translation="MIQARSVRLAAVIVLGGAVALATSACGGPMQAGAAAVVQGQRTTD
FT                   ATVQDQVASIVSLVQHNNLQQGDVTDEERSALAKAQINLLVQQAVWQKVADDNGVKVTA
FT                   ADDAKEHSALVEQARGSLQGTKFTGSDNEAVALADAESQQNSSGLAPSSVPVYSHIQAL
FT                   VTAVIDDQATKLRVDPNDQNSLPALQGAILPMLSKASTQIDVKISPRYGSFDASTRQVV
FT                   AAQTSWIRPTKAQVAAAAAAQAQQQQSQ"
     atgatccagg cccgctcggt ccgtctcgcc gccgtcatcg tgctcggcgg ggcagtagcc        60
     ctggccacct ccgcgtgcgg cggcccgatg caggccgggg ccgcggccgt ggtgcagggg       120
     cagcggacca ccgacgccac cgtccaggac caggtcgcct cgatcgtgtc cctggtgcag       180
     cacaacaacc tgcagcaggg cgacgtcacc gacgaggagc gctcggcgct ggccaaggcg       240
     cagatcaacc tgctggtgca gcaggcggtg tggcagaagg tcgccgacga caacggcgtg       300
     aaggtcaccg ccgccgacga cgccaaggag cacagcgccc tggtcgagca ggcgcgcggc       360
     tcgctgcagg gcacgaagtt caccggcagc gacaacgagg ccgtggcgct ggccgacgcc       420
     gagtcccagc agaactcctc gggcctggcg ccctccagcg tgccggtcta ctcccacatc       480
     caggcgctgg tcaccgcggt gatcgacgac caggcgacca agctgcgcgt ggaccccaac       540
     gaccagaaca gcctgccggc gctgcagggc gcgatcctgc cgatgctgtc caaggcctcc       600
     acccagatcg acgtcaagat ctcgccgcgc tacggcagct tcgacgcctc cacccgccag       660
     gtcgtcgcgg cgcagacctc gtggatccgg ccgaccaagg cccaggtcgc cgccgcggcc       720
     gccgcgcagg cgcagcagca gcagtcccag tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page