(data stored in ACNUC7421 zone)

EMBL: CP001700.PE191

CP001700.PE191       Location/Qualifiers
FT   CDS_pept        complement(207411..208415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69146"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ04"
FT                   /inference="similar to AA sequence:KEGG:SCO7720"
FT                   /protein_id="ACU69146.1"
FT                   /translation="MRGKGVNYDTGFFPGGQDSRPDFDPETARRELRVIAEDLHCTAVR
FT                   ISGALPDRLEAAAQAAADAGLEVWFAPFPCEASREDLLELLADCAQRAERLRAAGAEVV
FT                   FVAGCETSLFCPGYFDGDDSYARIETLGNGGMALWSRLGEIMASFNGYLVEAAATVREH
FT                   FQGKVTYAAGPWEFIDWAPFDFVSVDAYRSAENRDKFADQIRAHFKHGKPVVATEFGCT
FT                   PYVGSGDRGGMAWAILDDSVEPPVVNGDYLRSEDEQSAYFTELYDVFEEAGVDSAFWFT
FT                   FATFRALHDPSDPRKDLDLAAYGTVKMTGPDTPELNWEPKKVFHTIAERYAAS"
     atgcgcggca agggcgtcaa ctacgacacg ggattcttcc ccggcggcca ggactcgcgg        60
     ccggacttcg atccggagac cgcccggcgc gagctgcggg tgatcgccga ggatctgcac       120
     tgcaccgcgg tccggatctc cggggcgctg ccggaccggc tcgaagccgc ggcacaggcc       180
     gccgccgacg ccgggctgga ggtctggttc gcgccgttcc cttgtgaagc gtcgcgggag       240
     gacctgctgg aactgctggc cgactgcgcg caacgcgccg agcgcctccg cgccgccggc       300
     gccgaggtgg tgttcgtggc gggctgcgag acctcgctgt tctgcccggg ctacttcgac       360
     ggcgacgact cctatgcccg catcgagacc ctcggcaatg gcgggatggc gttgtggagc       420
     cggctcgggg agatcatggc ctcgttcaac ggctacctgg tcgaggcggc ggcgacggtg       480
     cgcgagcact tccaggggaa ggtcacgtac gcggccgggc cgtgggagtt catcgactgg       540
     gcgccgttcg acttcgtgtc cgtggacgcc tatcgctcgg cggagaaccg ggacaagttc       600
     gccgaccaga tccgcgcgca cttcaagcac ggcaagccgg tggtcgccac cgagttcggc       660
     tgcaccccct acgtcggctc cggcgaccgc ggcggcatgg cctgggcgat cctggacgac       720
     tccgtcgagc cgccggtggt caatggcgac tacctgcgca gcgaggacga gcagtccgcg       780
     tacttcacag agctctacga cgtcttcgag gaagccggcg tcgactccgc gttctggttc       840
     accttcgcca cgttccgggc cctgcacgac ccctcggacc cgcgcaagga cctggacctg       900
     gccgcgtacg gcacggtgaa gatgaccggt ccggacaccc cggagctgaa ctgggagccg       960
     aagaaggtgt tccacacgat cgcagaacgg tacgcggctt cctag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page