(data stored in ACNUC7421 zone)

EMBL: CP001700.PE192

CP001700.PE192       Location/Qualifiers
FT   CDS_pept        complement(208489..209226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69147"
FT                   /db_xref="GOA:C7QJ05"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ05"
FT                   /inference="similar to AA sequence:KEGG:SAV_4727"
FT                   /protein_id="ACU69147.1"
FT                   /translation="MTAMTAHTHRTADVTADGAGVADVADGETPHPLKQALLPLAVDIA
FT                   IPLGSYYALHAGLGMSNAAALGLSSVVPAIRTIVAAVGKRQANALAALMLTVNIVAIAL
FT                   TFVSGDARLMLAKDSGVSSVIALGILWSVRGGKPMMSAGLKPFVTKGDAKQTAAWDALR
FT                   IESSTFRAKENLYSVIWGAWLLTECLARLAGAFLLPVSTMAWLGTVILIVAIAGACVTG
FT                   GAAVEPLEKLVAAHVEAASDAEH"
     atgaccgcca tgaccgcgca cacccaccgc accgccgacg tcaccgctga tggcgccggc        60
     gtcgccgatg tcgccgatgg cgagacgccg cacccgctca agcaggctct gctgccgctc       120
     gccgtcgaca tcgcgatccc gctcggcagc tactacgcgc tgcacgccgg gctcggcatg       180
     agcaacgcgg ccgcgctggg cctgagcagc gtggttccgg cgatccgcac catcgtcgcg       240
     gcggtcggca agcgccaggc gaacgcgctg gccgcgctga tgctgacagt gaacatcgtg       300
     gccatcgcgc tgaccttcgt ctccggcgac gcgcgcctga tgctggcgaa ggactccggg       360
     gtcagcagcg tgatcgctct cgggatcctg tggtcggtcc ggggcggcaa gccgatgatg       420
     tccgcgggtc tgaagccgtt cgtcaccaag ggcgacgcga agcagaccgc ggcgtgggac       480
     gcgctgcgga tcgaaagttc cacgttccgc gccaaggaga acctgtacag cgtgatctgg       540
     ggcgcgtggc tgctgaccga gtgcctggcg cggctcgccg gggcgttcct gctgccggtc       600
     tccacgatgg cctggctggg caccgtgatc ctgatcgtgg cgatcgccgg cgcgtgcgtc       660
     accggcggcg ccgccgtcga gccgctggag aagctcgtcg cggcgcacgt cgaggccgcc       720
     tccgacgccg agcactga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page