(data stored in ACNUC7421 zone)

EMBL: CP001700.PE193

CP001700.PE193       Location/Qualifiers
FT   CDS_pept        209307..209954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0193"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO4450
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69148"
FT                   /db_xref="GOA:C7QJ06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ06"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69148.1"
FT                   /translation="METQGLRERKKRQTREEIANVATALFAELGFEKVTIAEVAAAAGV
FT                   AKMTVTNHFPLKEDLVFDRAEHIVHGLPDAVAARPDGEPVLAAARRYHAQQLAAGDPTL
FT                   GHRGVDFSRMVESSPALAARERQIHDQREQALAEVLVAQTRPAEELTARVAAAQIAGVY
FT                   RVLYFTARRFLLDGLQGPEMAETLGACAQRAFTLLEVDLSGFDPRPRLRSTA"
     atggagaccc aaggactgcg ggaacgcaag aagcggcaga cccgcgagga gatcgccaac        60
     gtcgccaccg cgctgttcgc cgagctcggc ttcgagaagg tgaccatcgc cgaggtcgcc       120
     gcggccgccg gcgtggcgaa gatgaccgtc accaaccact tcccgctcaa ggaggacctg       180
     gtcttcgacc gcgcggagca catcgtccac gggctcccgg acgccgtcgc ggcccggccg       240
     gacggcgagc cggtcctggc cgcggcccgc cgctaccacg ctcagcagct ggcggccggg       300
     gacccgaccc tcgggcaccg gggcgtggac ttctcgcgga tggtcgagtc cagcccggcg       360
     ctggccgcgc gcgagcgcca gatccacgac cagcgcgagc aggcgctggc cgaggtcctg       420
     gtggcgcaga cgcggccggc cgaggagctg acggcgcgcg tcgccgccgc gcagatcgcc       480
     ggggtctacc gggtcctgta cttcacggcc cgccggttcc tgctggacgg gttgcagggc       540
     ccggagatgg ccgagacgct cggcgcctgc gcgcagcgcg ccttcaccct cctcgaagtc       600
     gatctcagcg gcttcgaccc gcgcccccgc ctacgatcta ctgcatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page