(data stored in ACNUC7421 zone)

EMBL: CP001700.PE194

CP001700.PE194       Location/Qualifiers
FT   CDS_pept        209951..211027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0194"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: sgr:SGR_4434 MazG family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69149"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ07"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACU69149.1"
FT                   /translation="MTEAPPPDPENPQGPENSGRIVFLATSPRVALGLLSWPAWETLRA
FT                   ADVVFAGDADHPHIPYVEQATGAVVALPDHSPSMAAERLLEAATPARTVVWLAEDEEYD
FT                   EELAVALGNRLVLLASADLPELEVLPGSYDLPGAHLLDLVDVMNRLRSPGGCPWDAEQT
FT                   HASLVKYLLEEAYETVETIEDGDPLTPGPGRDALREELGDVLLQVMFHSRIAEEHEADP
FT                   FSVDDVADGIVAKLIRRHPHVFADVEAPTAEHVAANWEQIKAAEKQRESVTEGVPMTQP
FT                   ALALVAKLAGRVRKSGLVVPAGPAPDLPDTADELGEQLLATAIKAVGAGWDPEEALRTA
FT                   ARRYRDRVITAEEELARG"
     atgaccgaag ccccgccgcc ggatcccgag aacccccaag gcccggagaa ctccggccgc        60
     atcgtcttcc tcgccacctc cccgcgcgtc gcgctcggcc tgctgtcctg gccggcgtgg       120
     gagacgctgc gcgcggcgga cgtggtcttc gccggcgacg ccgaccatcc gcacatcccc       180
     tacgtcgagc aggccaccgg cgccgtcgtc gcactgccag accacagccc gtcgatggcc       240
     gccgaacgcc tcctggaggc cgccacaccg gcccgcacgg tcgtctggct cgccgaggac       300
     gaggagtacg acgaggaact ggccgtggcg ctggggaacc gcctggtgct cctggcctcc       360
     gcggacctgc ccgagctgga ggtgctgccc ggctcctacg acctgcccgg cgcgcacctg       420
     ctcgacctcg tggacgtcat gaaccggctg cgctccccgg gcggctgccc gtgggacgcc       480
     gaacagaccc acgcctcgct ggtgaagtac ctgctcgaag aggcctacga aaccgtcgag       540
     acgatcgagg acggcgaccc gctgaccccc ggcccgggcc gcgacgcgct gcgcgaggag       600
     ctcggcgacg tcctgctgca agtgatgttc cactcacgca tcgccgaaga gcacgaagcc       660
     gatccgttct cggtggacga cgtcgccgac ggcatcgtgg ccaaactgat ccgccggcac       720
     ccgcatgtct tcgcagacgt cgaggctccc accgccgaac acgtcgcggc gaactgggag       780
     cagatcaagg ccgcggagaa gcagcgggag tcggtgaccg agggggttcc gatgacccag       840
     ccggcgttgg cgctggtggc gaagctggct ggccgggtgc gcaaatccgg cctcgtcgtt       900
     ccggccggac ccgctccgga ccttccggac accgccgacg aactgggcga gcagctgctg       960
     gcgacggcga tcaaggcggt cggggcgggc tgggatccgg aagaagcgct gagaacggcc      1020
     gcgcgacggt accgtgaccg cgtcattacg gcggaggagg agctagccag ggggtag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page