(data stored in ACNUC7421 zone)

EMBL: CP001700.PE196

CP001700.PE196       Location/Qualifiers
FT   CDS_pept        complement(211522..212493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69151"
FT                   /db_xref="GOA:C7QJ09"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69151.1"
FT                   /translation="MPPQDWAPPMPPQQDRVPPMPQPDRGPYPQFTQQPPPPQFTPPQM
FT                   PGMPYPDEEPPPRKNTGRIIAGVVAGVVLLGGAGGIYLLTKGDSKKDTKPQPVAAATSA
FT                   TTPATTPAAPGTPASSGATSFPNNSYTGSAAAPPASASSTGGGATLDNAATDKTPFTAQ
FT                   ALVAQSFTDDKNVAYALKSAQPQPCAKVGDAAVQTIVKSAKCTDFMAASWIDPANSRIV
FT                   VSAMVIPYQDAATATAIYKKLSTTHTGDYAQWCPPAGQPGADTCAKLAKAGAVTREGKF
FT                   GSFHRYVLITTAVYADLRNDDSQKDWLTSAAHGAFQNTLPGQ"
     atgccgccgc aggactgggc gccgcccatg ccgccgcagc aggaccgggt gccgccgatg        60
     ccgcagccgg atcggggtcc gtatccgcag ttcacccagc agccgccgcc cccgcagttc       120
     acgccgccgc agatgcccgg tatgccctat cccgacgagg aacccccgcc gaggaagaac       180
     accgggcgga tcatcgccgg cgtcgtcgcc ggggtggtgc tcctgggcgg tgcgggcggt       240
     atctacctgt tgaccaaggg cgacagcaag aaggacacca agcctcagcc ggtcgcggcg       300
     gcgacttcgg cgaccactcc ggcgaccact ccggccgcgc cgggcacgcc cgcgtcctcg       360
     ggtgcgacgt cgttcccgaa caacagctac accggttcgg cagcggcgcc gcccgcctcg       420
     gcctcgtcca ccggcggcgg cgcgacgctg gacaacgcgg ccacggacaa gacgccgttc       480
     accgcgcagg cgctggtggc gcagtcgttc acggacgaca agaacgtggc ctacgcgctg       540
     aagtccgcgc agccccagcc gtgcgcgaag gtcggcgacg cggcggtgca gaccatcgtg       600
     aagagcgcca agtgcacgga cttcatggcc gcctcctgga tcgacccggc caacagccgg       660
     atcgtggtca gcgcgatggt catcccctat caggacgccg cgaccgccac ggcgatctac       720
     aagaagctga gcacgaccca caccggcgac tacgcgcagt ggtgcccgcc ggccgggcag       780
     cccggcgcgg acacctgcgc caagctcgcc aaggccggcg cggtgacccg cgagggcaag       840
     ttcggcagct tccaccgcta cgtgctgatc accacggcgg tctacgccga cctgcgcaac       900
     gacgacagcc agaaggactg gctgacctcc gccgcgcacg gcgcgttcca gaacaccttg       960
     ccggggcagt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page