(data stored in ACNUC7421 zone)

EMBL: CP001700.PE197

CP001700.PE197       Location/Qualifiers
FT   CDS_pept        212732..214468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0197"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   ace:Acel_1952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69152"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ10"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACU69152.1"
FT                   /translation="MADTPDARFEALAADILDGLWRRHPDWAGTVGLHEYDAELPDRSA
FT                   GGLAAEAAWLAGRAEDLADLDPAALSVPNRVDAAILANQLAALRFQIEDLREDEWNPAE
FT                   ANPGVALYTLLARDYAPAAQRLSAFAGRLEQVPSALLDNRSLLAGKPLSRIHVELAIGQ
FT                   FEGTVDLIGAELDAAVAAASEAASKAGSEADSEAVSQARKAIDAVRPDASAALQEHIVW
FT                   LKERLAAGDAGEEEFRDPRIGAELFTRKLSLSLDAESDAAAILARAEADLDRVSAEIAE
FT                   AAADYEGVAVPSDEAERSALVRRVLDRLAESAPDNETILEYSRQALLAQFAFVRDHDLV
FT                   TVYPDPYEVVEMPEVHRGVSVAYCDPPGPMEPAEVQTILAISPTPEGWTQERVDSFFRE
FT                   YNRHMLHNLMVHEAMPGHLLQLQHSRRQQAPTSVRAALWSGSFVEGWAVYAEALMARHG
FT                   YPGDGDPRAVRMQQLKMQIRMIINTVLDSRIHCHGMTEDEAMALMTGRGYQEDGEAAGK
FT                   WRRALLSSTQLSTYYVGYKEVSDLVRDLRADHPEWSERQVHDAVLGHGSPPARYLRDLI
FT                   AA"
     atggcagaca cccctgacgc acgcttcgag gcactggccg ccgacatcct ggacggtctg        60
     tggcgccgcc atccggactg ggccggcacg gtgggcctgc acgagtacga cgcggaactg       120
     cccgaccggt ccgccggcgg actggccgcc gaagccgcct ggctcgccgg acgcgccgag       180
     gacctcgccg acctggaccc cgcggcgctc tcggtgccga accgcgtgga cgccgcgatc       240
     ctggccaacc agctggccgc gctgcgcttc cagatcgagg atcttcgcga ggacgagtgg       300
     aatccggcgg aggcgaatcc gggtgtcgcc ttgtacacgc tgctggcgcg cgactacgcc       360
     ccggcggcgc agcggctgag cgctttcgcc ggacgtctgg agcaggtgcc gtcggcgctg       420
     ctggacaacc ggtcgctgct ggccggcaag ccgctgtcgc ggatccacgt ggagctggcg       480
     atcgggcagt tcgagggcac ggtcgacttg atcggcgccg agctggacgc ggcggtcgcg       540
     gcggcatccg aagccgcgtc caaggcgggc tccgaggctg actccgaggc cgtttcccag       600
     gcgcggaaag cgatcgacgc ggtccgtccg gatgcctcgg cggcgcttca ggaacacatc       660
     gtctggctca aggagcggct ggctgccgga gacgcggggg aggaggagtt ccgcgacccg       720
     cgcatcggtg cggaactgtt cacccgcaag ctgtcgctga gtctcgacgc cgagtcggac       780
     gcggcggcga tcctggcgcg cgcggaggcc gacctggacc gcgtctcggc cgagatcgcc       840
     gaggcggctg ccgactacga gggcgtcgca gtgccctcgg atgaggcgga gcgctcggcg       900
     ctggtacggc gggtgttgga ccgcctcgcc gagtccgccc cggacaacga gaccatcctg       960
     gagtacagcc ggcaggcgct gctggcgcag ttcgccttcg tgcgcgatca cgacctggtg      1020
     accgtgtatc cggaccctta tgaagtcgtc gagatgccgg aggtgcaccg gggcgtgtcg      1080
     gtcgcgtact gcgatccgcc gggaccgatg gagccggccg aggtgcagac gatcctggcg      1140
     atctcgccga cgcccgaagg ctggacgcag gagcgcgtcg actccttctt ccgcgaatac      1200
     aaccggcaca tgctgcacaa cctgatggtc cacgaggcga tgccggggca cctgctccag      1260
     ttgcagcact cgcgccgcca gcaggcgccg acgtcggtgc gtgccgcgct gtggtccggc      1320
     tcgttcgtcg agggctgggc cgtctacgcc gaagcactga tggcccgcca cggatatccc      1380
     ggcgacggcg acccgcgcgc ggtgcggatg cagcagctga agatgcagat ccgcatgatc      1440
     atcaacaccg tcctggacag ccgcatccac tgccacggca tgaccgagga cgaggccatg      1500
     gcgttgatga ccgggcgcgg ctaccaggag gacggcgagg ccgccggcaa gtggcggcgg      1560
     gcactgctga gcagcacgca gctgtccacc tactacgtcg gctacaaaga ggtcagcgac      1620
     ctggtccgcg acctgcgagc cgaccacccc gagtggtcgg agcgccaggt gcacgacgcg      1680
     gtgctgggcc acggctcgcc gcccgcgcgg tatctcaggg acctgatcgc ggcctga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page