(data stored in ACNUC7421 zone)

EMBL: CP001700.PE198

CP001700.PE198       Location/Qualifiers
FT   CDS_pept        complement(214500..215156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0198"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: sma:SAV_4878 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69153"
FT                   /db_xref="GOA:C7QJ11"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ11"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69153.1"
FT                   /translation="MPEPIRVLIAEDAVLLREGLARLLADSGFDVVAKVDDGKGMVEAA
FT                   DALKPDVIVADVRMPPSFTDEGLRAAVQVRAKYPDMAILVFSQAVEAAYAQELFSTSAN
FT                   GLGYLLKERVAEVEEFVDALKRVAAGGTALDPEVVAQLLGRRKRNDPLETLTPREREVL
FT                   AMMAEGRSNSAIAAGLFVTEKAVEKHTSSIFTKLNLTPAAEDHRRVMAVLRYLNV"
     atgcccgaac ccatccgcgt cctgatcgcc gaagacgcgg tcctgctccg cgagggcctg        60
     gccaggctcc tcgcggattc ggggttcgac gtcgtggcga aggtcgacga cggcaagggc       120
     atggtcgagg ccgccgacgc cctgaagccg gacgtgatcg tcgccgacgt ccgcatgccg       180
     ccgagcttca ccgacgaggg actgcgcgcg gcggtgcagg tccgagctaa ataccctgat       240
     atggccatcc tggtcttcag ccaggccgtc gaggccgcct acgcgcagga gctgttctcc       300
     accagcgcca acggtctggg ctacctgttg aaggagcgcg tcgccgaggt cgaggagttc       360
     gtcgacgccc tgaagcgggt cgccgccggc ggcacggcgc tggatcccga ggtcgtggcg       420
     cagcttctgg gccgccgcaa gaggaacgac ccgctggaga cgctgacgcc gcgcgagcgc       480
     gaggtgctgg cgatgatggc cgagggccgc tccaactcgg cgatcgccgc cgggctgttc       540
     gtcaccgaga aggcggtgga gaagcacacg tcgagcatct tcaccaagct gaacctcacg       600
     ccggcggcgg aggaccaccg ccgggtgatg gcggtcctgc gctacctgaa cgtctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page