(data stored in ACNUC7421 zone)

EMBL: CP001700.PE199

CP001700.PE199       Location/Qualifiers
FT   CDS_pept        complement(215132..216490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0199"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sma:SAV_4879 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69154"
FT                   /db_xref="GOA:C7QJ12"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ12"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU69154.1"
FT                   /translation="MITTVGAKAAARREGDTAPTLGPGELLKGPFTGRALRQQGYLLVS
FT                   FVAAFVQVLVLTVTLALGGALVVLVVGLPLLLAGLVSLRWNSRRERLRILRLTGERVPE
FT                   PYREPGPSGNPLQRLLGHLSDPATWRDLVHLVVASGLGLGWFLVAVGSWVLPLGAVTLP
FT                   FWYTALPEHRIPLMHVNGSEYYISTLPSILAFSAVTLAFVWLVNPTLLELGTRTQTGLG
FT                   RALLGLSRLELDRRETALRTTRSQAVSAAEAERRRIERDLHDGAQQRLVALAMDLGRAK
FT                   SKLKTGDEADSEAAAQLVAEAHEGVKLALSELRDLARGIHPAVLTDRGLDAALSALAGR
FT                   SPIPVEVDADLPWRPSPEVESAAYFVASEALANMAKHAHATRAWIELEIREDHLRMIVG
FT                   DNGVGGAQTDPGGGLDGLSDRIAPLDGILSVSSPLGGPTQIIMEMPCPNPSAS"
     atgatcacga ctgtgggagc caaggccgcc gcccggcgcg agggggacac cgcgccgacg        60
     ctcggcccgg gcgagctgtt gaagggtccc ttcaccggcc gcgccctgcg ccagcagggg       120
     tacctgctgg tctcgttcgt cgcggcgttc gtgcaggtcc tggtgctgac ggtgacgctg       180
     gccctcggcg gcgcgctggt cgtgctggtc gtcgggctgc cgctgctgct ggccgggctg       240
     gtgagcctgc gctggaacag ccggcgcgag cggctccgga tcctgcgcct gaccggcgag       300
     cgggtgcccg agccctaccg ggagcccggg ccctccggca acccgctgca gcggctgctg       360
     ggccacctgt ccgaccccgc gacctggcgg gacctggtgc acctggtggt ggcctcgggc       420
     ctgggactcg gctggttcct cgtggcggtg ggcagctggg tgctgccgct cggcgcggtc       480
     acgctgccgt tctggtacac cgcgctgccg gagcaccgga tcccgctgat gcacgtgaac       540
     ggcagcgagt actacatcag cactctgccg tccatcctcg ccttctccgc ggtcacgctg       600
     gccttcgtct ggctggtcaa cccgaccctg ctggaactgg ggacccggac ccagaccggt       660
     ctgggccgcg ccctgctcgg gctgagccgc ctggagctgg accgccgcga gacggcgctg       720
     cgcaccaccc gcagccaggc cgtcagcgcc gccgaagccg agcgccgccg gatcgagcgc       780
     gacctgcacg acggcgcgca gcagcggctg gtcgccctgg cgatggacct gggccgggcc       840
     aagtcgaagc tgaagaccgg cgacgaggcc gattccgagg ccgccgcgca gctggtcgcc       900
     gaagcgcacg aaggcgtgaa gctggccctg agcgagctgc gcgatctggc gcgcggcatc       960
     cacccggcgg tcctgaccga ccgcggcctg gacgcggcgc tgtccgccct ggccggccgc      1020
     tccccgatcc cggtggaggt ggacgccgac ctgccctggc gcccgagccc ggaagtggag      1080
     tcggcggcgt acttcgtggc ctccgaggcg ctggcgaaca tggccaagca cgcccacgcc      1140
     acccgcgcct ggatcgagct ggagatccgc gaggaccacc tgcggatgat cgtcggcgac      1200
     aacggcgtcg gcggtgcaca aaccgatccc ggcggcggtc tcgatggtct gtccgaccgc      1260
     atcgcgccac tggatggcat cctgtcggtc agcagcccac tcgggggacc gacccaaatc      1320
     atcatggaga tgccatgccc gaacccatcc gcgtcctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page