(data stored in ACNUC7421 zone)

EMBL: CP001700.PE2

CP001700.PE2         Location/Qualifiers
FT   CDS_pept        2834..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sco:SCO3878 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68957"
FT                   /db_xref="GOA:C7QFL8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU68957.1"
FT                   /translation="MKFRVERDVLSEAVAWTARSLPSRPAAPVLAGLVFEAVEGEGGED
FT                   HGSVTLSGFDYEVSSRAQIGADVTEPGRILIHGKLLADIAKSLPNRPVEFSTEGSKVLL
FT                   SCGSSRFTLQTLPVEDYPALPTMPTATGAVTASGLAGAVSQVAIAAGRDDTIPMLTGIR
FT                   VEIEGEKITLVATDRFRLAVRELQWKPEQDDMSATALIPSKVLSDTAKALTGGDWVSLA
FT                   LSGGDAGEGLIGFESGEGTSGKAKGSRRMTSRLLSGEFVKYRSLFPNEYNITATVETAP
FT                   FLEAAKRVSLVADRTSPIKLAFTQGEVTLEAGAGDEAQASEAMDAVLDGEDISVSFNPS
FT                   FLLDGLQVIDTQYAQLSFTVASKPAVLMGRPALDAPAQEEFRYLMMPLRVPGQSAG"
     gtgaagttcc gggtggagcg cgacgtcctt tccgaggccg tggcatggac tgcgcggtcc        60
     ctgcccagcc gcccggcggc cccggtcctg gccgggctgg tcttcgaggc cgtggaggga       120
     gaaggcggcg aggaccacgg ctcggtcacg ctgtccggct tcgactacga ggtctcctcc       180
     cgggcccaga tcggtgccga cgtcaccgag ccgggccgga tcctgatcca cggcaagctg       240
     ctggcggaca tcgccaagtc gctgccgaac cgccccgtgg agttctccac cgagggctcg       300
     aaagttctcc tcagctgtgg atccagccgc ttcaccctgc agaccctgcc ggtggaggac       360
     tacccggcgc tgccgaccat gccgaccgcg accggcgccg tcaccgcctc cggcctggcc       420
     ggggcggtct cccaggtggc catcgccgcc gggcgcgacg acaccatccc gatgctcacc       480
     ggcatccgcg tggagatcga gggcgagaag atcaccctgg tcgccaccga ccggttccgg       540
     ctggccgtcc gcgagctcca gtggaagccg gagcaggacg acatgtccgc gaccgcgctg       600
     atcccctcca aggtcctgtc ggacaccgcg aaggcgctca ccggcggcga ctgggtctcc       660
     ctggcgctgt ccggcggcga cgccggcgag ggtctgatcg gtttcgagtc cggcgaaggt       720
     acctccggca aggccaaggg ctcgcggcgg atgacgtccc gcctgctgtc cggggagttc       780
     gtgaagtacc gctcgctgtt cccgaacgag tacaacatca ccgcgaccgt cgagaccgcg       840
     ccgttcctgg aggccgccaa gcgcgtgtcc ctggtggccg accgcacctc gccgatcaag       900
     ctggccttca cccagggcga ggtcaccctg gaggccggcg cgggcgacga ggcgcaggcc       960
     tccgaggcca tggacgcggt cctggacggc gaggacatca gcgtctcgtt caatcccagc      1020
     ttcctgctcg acggcctgca ggtgatcgac acccagtacg cgcagctgtc gttcaccgtc      1080
     gcctccaagc ccgcggtgct catgggccgc ccggcgctgg acgccccggc gcaggaggaa      1140
     ttccgttacc tgatgatgcc gctccgagtt cctggtcagt ccgcgggctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page