(data stored in ACNUC7421 zone)

EMBL: CP001700.PE20

CP001700.PE20        Location/Qualifiers
FT   CDS_pept        complement(21461..22336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0020"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: nfa:nfa38930
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68975"
FT                   /db_xref="GOA:C7QFN6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68975.1"
FT                   /translation="MGMSAVRSPYAAKLGGRIRQFRMERALSSGELAAAASVTSSAVSK
FT                   VEHGKMVPSRDVLARIVTALNLPAEEQESLFDLLGQAAADAASNRGYGKGLTLLNQIAD
FT                   RERVCSAVSTFSNSIIPRLLQTAEYARDANRLTPWLSEREVGKAAMTHTERQSVLFEDG
FT                   REFTFLITEGVLRTWPGELTVMAAQFDRLRQMAVHPGVRVGILPWTSAMRGLPMVTFTL
FT                   YDDREVAVEMFTGELLMAQPDKVSTHVAQFRRFEESAVYGEEAIGLINRVEMDLARLPP
FT                   LALDEDLSSK"
     atgggtatga gtgcggtgcg aagtccttac gcggccaagc tgggcggccg gatccggcag        60
     ttccggatgg agcgcgcgct gtccagcggc gagctcgcgg ccgccgcctc tgtcacgtcc       120
     tcggcggtgt ccaaggtcga gcacggcaag atggtcccca gccgggacgt gctggcccgg       180
     atcgtcactg ctttgaacct gccggccgag gagcaggaga gcctgttcga cctgctcggc       240
     caagccgccg ccgatgccgc gagcaaccgc ggctacggca agggcctgac cctgctgaac       300
     cagatcgccg accgcgagcg ggtctgctcg gcggtgtcga cgttctcgaa ctcgatcatc       360
     ccgcgcctgc tgcagaccgc cgagtacgcc cgcgacgcca accggctcac cccctggctg       420
     tccgagcgcg aggtcggcaa ggccgcgatg acccacaccg agcggcagtc ggtgctgttc       480
     gaggacggcc gggagttcac cttcctgatc accgagggcg tcctgcgcac ctggcccggc       540
     gagctgacgg tgatggccgc gcagttcgac cggctgcggc agatggcggt gcatcccggg       600
     gtgcgagtcg ggatcctgcc ctggacctcg gcgatgcgcg ggctgccgat ggtcaccttc       660
     accctgtacg acgaccgcga ggtcgcggtg gagatgttca ccggcgagct gctgatggcg       720
     cagcctgaca aggtctcgac acatgtcgcg cagttccggc ggttcgagga gtcggctgtg       780
     tacggtgaag aggcgatcgg cctgatcaac cgggtggaga tggacctcgc gcggctgccc       840
     ccgctggctc tggatgagga tctgtcatcc aaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page