(data stored in ACNUC7421 zone)

EMBL: CP001700.PE200

CP001700.PE200       Location/Qualifiers
FT   CDS_pept        216643..217491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0200"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: rha:RHA1_ro00243
FT                   ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69155"
FT                   /db_xref="GOA:C7QJ13"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ13"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ACU69155.1"
FT                   /translation="MEELPTLPVLIARIESSHPFSDPLARLADAVETGASISALADHLV
FT                   GHFVDEARAAGASWAQIGVALGVSKQAVQQRFVPREPATVADFDIEVQRFSRFTPRCLN
FT                   CVLGAEKIAVATGAAAVTPTHILIGLFVEPQSLAIHALADNGADPAQVRAAAVETLPPA
FT                   PEGATVLATATATAPSQEPAIPGNSLPFTPEARKTFDLAVRAALSAGHNYVGTEHLLLA
FT                   LAGDPKSETALLLTSFGLTRDGLEASVQRLLMEFMANSGRRGSGVSPLDPAEQGAPPAE
FT                   G"
     atggaagagc tcccgaccct cccggtcctg atcgcccgca tcgagtccag ccatccgttc        60
     tccgaccccc tggcccggct cgccgacgcc gtcgagaccg gcgcctccat ctcagccctc       120
     gccgaccacc tcgtcggcca cttcgtcgac gaggcccggg ccgccggcgc ctcctgggcg       180
     cagatcggcg tcgcgctcgg cgtctccaag caggcggtgc agcagcgctt cgtgccgcgc       240
     gagccggcga ccgtcgccga cttcgacatc gaggtccagc gcttcagccg cttcactccg       300
     cgctgcctga actgcgtcct gggcgcggag aagatcgccg tggcgaccgg cgccgccgcc       360
     gtgacgccga cccacatcct gatcggtctg ttcgtcgagc cgcagagcct ggccatccac       420
     gccctggcgg acaacggcgc ggatccggcg caggtccggg cagccgccgt cgagactctg       480
     ccgccggctc cggagggcgc gactgtactg gcgacggcga cggcgacggc gccgtcccag       540
     gaaccggcca tccccgggaa ttcgctgccc ttcactcccg aggcgcgcaa gaccttcgat       600
     ctggcggtgc gcgccgcgct gtccgccgga cacaactacg tcggcaccga gcaccttctc       660
     ctggcgctcg ccggcgatcc gaaatccgag acggcgcttc ttctgacgtc cttcggcctc       720
     acccgggacg gcctggaggc ctctgttcag cgcctgctca tggaattcat ggcgaactcc       780
     gggcggcgcg gctccggtgt ctcacccctt gaccctgctg agcaaggtgc tccgcctgcc       840
     gaaggatag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page