(data stored in ACNUC7421 zone)

EMBL: CP001700.PE201

CP001700.PE201       Location/Qualifiers
FT   CDS_pept        217533..218819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0201"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: sgr:SGR_4439 putative enolase; TIGRFAM:
FT                   enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69156"
FT                   /db_xref="GOA:C7QJ14"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ14"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACU69156.1"
FT                   /translation="MASIEAINAREILDSRGNPTVEVEVLLEDGSFARAAVPSGASTGA
FT                   FEAVELRDGDAARYGGKGVERAVQGVLDEIYPAVVGEDASDQRLIDQAMIDLDATPNKA
FT                   RLGANALLGVSLAVAKAAAESAELPLFRYLGGPNAHTLPVPMMNILNGGAHADSNVDIQ
FT                   EFMIAPIGAGSFREALRWGAEVYHALKSVLKERGLNTGLGDEGGFAPSLPSNRDALDLI
FT                   LVAIEKAGYTPGRDIALALDVAASEFYKDGAYQFEGKSRTASEMTDYYAELVDAYPLVS
FT                   IEDPLFEDDWDGWKILTDRLGTQVQIVGDDLFVTNPERLARGIAGGQANALLVKVNQIG
FT                   TLTETFDAVQLAHRNGYRCMMSHRSGETEDTTIADLAVAVDCGQIKTGAPARSDRVAKY
FT                   NQLLRIEEELDDAARYAGRSAFPRFTHEG"
     gtggcgtcca tcgaagccat caacgcccgg gagatcctgg actcgcgcgg caacccgacc        60
     gtcgaggtcg aagtgcttct cgaagacggc agcttcgccc gcgcggcggt cccctccggt       120
     gcctccaccg gcgccttcga ggccgtggaa ctgcgcgacg gcgacgcggc ccgctacggc       180
     ggcaagggcg tcgagcgcgc cgtgcagggc gtcctggacg agatctaccc cgcggtggtc       240
     ggcgaggacg cctccgacca gcgcctgatc gaccaggcga tgatcgacct ggacgccacg       300
     ccgaacaagg cgcgcctggg cgccaacgcc ctgctgggcg tctcgctggc ggtggccaag       360
     gccgccgccg agtccgccga gctgccgctg ttccgctacc tcggcggccc gaacgcgcac       420
     accctgccgg tgccgatgat gaacatcctc aacggcggcg cgcacgcgga ctccaacgtg       480
     gacatccagg agttcatgat cgccccgatc ggcgcgggca gcttccgcga ggcgctgcgc       540
     tggggcgcgg aggtctacca cgcgctgaag tccgtgctca aggagcgcgg cctgaacacc       600
     ggtctgggcg acgagggcgg cttcgcgccg agcctgccgt ccaaccgcga cgcgctggac       660
     ctgatcctgg tcgcgatcga gaaggccggc tacaccccgg gccgggacat cgcgctggcg       720
     ctggacgtcg ccgcctcgga gttctacaag gacggcgcct accagttcga gggcaagtcc       780
     cgcaccgcct cggagatgac cgactactac gccgagctgg tcgacgccta cccgctggtg       840
     tccatcgagg acccgctgtt cgaggacgac tgggacggct ggaagatcct caccgaccgc       900
     ctcggcaccc aggtgcagat cgtcggcgac gacctgttcg tcaccaaccc cgagcgcctc       960
     gcccgcggca tcgccggcgg ccaggccaac gcgctgctgg tgaaggtgaa ccagatcggc      1020
     acgctgaccg agaccttcga cgccgtgcag ctggcgcacc gcaacggcta ccgctgcatg      1080
     atgtcgcacc gctccgggga gaccgaggac accacgatcg ccgacctggc cgtcgcggtg      1140
     gactgcggcc agatcaagac cggcgccccg gcccgctcgg accgcgtcgc caagtacaac      1200
     cagctgctgc gcatcgagga ggagctcgac gacgccgcgc gctacgccgg ccgctcggcc      1260
     ttcccgcgct tcacgcacga gggctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page