(data stored in ACNUC7421 zone)

EMBL: CP001700.PE202

CP001700.PE202       Location/Qualifiers
FT   CDS_pept        218877..219518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0202"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: sma:SAV_3532
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69157"
FT                   /db_xref="GOA:C7QJ15"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ15"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACU69157.1"
FT                   /translation="MKSAGSGSTPGRLSAVPTQRQDAASGTSRSSGDGGSGSGASAKRR
FT                   TRYTARAAILMLVVCALVLALAYPLQQYFSQSSQINQLKQQNAHKRTQVQQLGRQLTQW
FT                   QDPDYVKIQARLRLHYVFPGETGLRLLGAGDAATGGPDGTTGPSQGSSAWYAQLWNSVT
FT                   AASGAPTSSGAPTTPATSGASGSAGASGPSGTPTPSGGPARSATSPAPGH"
     atgaagtcgg caggctcggg ctccacgccc ggacgcttga gcgcggtccc gacgcagcgc        60
     caggacgctg cgtcgggaac ttcgcgttcc tccggcgacg gcggctcggg ctccggcgcg       120
     tccgccaagc gccgcacgcg ctacacggcg cgcgcggcga tcctgatgct cgtggtctgc       180
     gcactggtcc tggccctggc ctatccgctg cagcagtact tctcgcagag ctcgcagatc       240
     aaccagctca agcagcagaa cgcgcacaag cgcacccagg tccagcagct cggccggcag       300
     ctcacgcaat ggcaggaccc ggactacgtc aagatccagg cccggctccg gctgcactac       360
     gtgttccccg gcgagaccgg cctccgcctg ctcggcgccg gagacgccgc gaccggcggc       420
     ccggacggca ccaccggacc ctcgcaggga tccagcgcct ggtacgcgca gctgtggaac       480
     tcggtgacgg cggcgagcgg ggcgccgact tcctcgggtg cgccgacgac gccggctacc       540
     tcgggtgcgt cgggttcggc gggcgcgtcg ggcccgtccg ggacgccgac tccttcgggc       600
     ggcccggctc gctcggcgac gtctccggcg cctggccact ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page